KEGG   Neisseria lactamica: NLA_17180Help
Entry
NLA_17180         CDS       T01368                                 

Definition
(GenBank) putative ribonuclease BN
  KO
K07058  membrane protein
Organism
nla  Neisseria lactamica
Brite
KEGG Orthology (KO) [BR:nla00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    NLA_17180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Virul_fac_BrkB
Motif
Other DBs
NCBI-ProteinID: CBN87923
UniProt: E4ZEY7
LinkDB All DBs
Position
1837891..1839111
Genome map
AA seq 406 aa AA seqDB search
MTVFSKYWQKGMENGGVAFLLFVARRFSEERVPQAAASMTFTTLLALVPVLTVTVAAVSV
FPVFESWSGAFVSFVKQTVVPQGADKVLDYLDAFRRQAGSLTAIGSVMLFVTSLMLVRTI
DQAFNRIWRVGAQRPWMMQFLVYWTLLTCGPLFLGVGISLTAGWGESWLLRPLAMPLGTV
LLLWGLYCFVPNRFVPARHALIGAAATALCLWCARALFVWYMGSFDGYRSIYGAFAAVPF
FLLWLNLLWTLVLGGAVLTASLSYWQGGAFRKNADARGGFDDVLDILLLLDAAQKRGKAL
RVRQFRRHIGMGYDELGALLEKLAHYGYVYSGRQGWVLKTGADAIKLDILFKRFAYRPCA
ANQNPVGQAVGRLVQPCLQSLEITLAEFAAQTGQTVSSNPPTTSEG
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgacggtattttcaaagtattggcaaaaaggtatggaaaacggcggcgttgccttcctg
ctgtttgtcgcccgccgtttcagcgaagagcgcgtacctcaggcggcggcgagtatgacg
tttaccacgctgctggctttggtgccggtgctgacggtaacggtggcggcggtttcggtc
tttccggtatttgagagctggtcgggtgcgtttgtgtccttcgtcaaacaaaccgtcgtg
ccgcaaggggcggacaaggtgctggattacctcgacgcgttccgccggcaggcaggcagc
ctgaccgccatcggcagcgtgatgctgttcgtcacgtcgctgatgctggttcggacgata
gaccaggcgtttaaccgcatttggcgcgtcggcgcgcagcgtccttggatgatgcagttc
ctcgtttattggaccctgctgacctgcgggccgctgtttttgggcgtgggcatctcgctg
acggcgggatggggggaatcgtggctgttgcgcccactggcgatgccgttgggaacggtg
ctgctgttgtgggggctgtactgctttgtccccaaccgtttcgtacccgcgcggcacgct
ttgatcggggcggcggcgacggctttgtgcctgtggtgcgcgcgcgcgctttttgtgtgg
tatatgggcagtttcgacggctaccgctcgatttacggcgcgtttgccgccgtgccgttt
ttcctgctgtggttaaacctgttgtggacgctggtgttgggcggggcggtgctgacggcc
tcactgtcgtattggcagggcggggcgtttcggaaaaatgcggacgcgcgcggcggcttt
gacgatgtgttggacattttactcttgctcgacgcggcgcaaaaacgcggcaaagccctg
cgggtccggcagttcagacggcatatcggtatgggctacgacgaattgggcgcgctcttg
gaaaaactggcgcactacggttatgtttattccgggcggcagggctgggttttaaaaaca
ggggcggatgccattaaattagacatactcttcaaacgctttgcgtaccgcccttgcgcc
gccaatcaaaaccctgtcggacaagccgtcggcaggctggtgcaaccctgccttcagtct
ttagagataacgctggcggagtttgccgcgcagaccgggcaaaccgtttccagcaatccc
cccacaacatccgaaggataa

DBGET integrated database retrieval system