KEGG   Neisseria lactamica: NLA_17350Help
Entry
NLA_17350         CDS       T01368                                 

Definition
(GenBank) putative peptidase
  KO
K07259  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase (penicillin-binding protein 4) [EC:3.4.16.4 3.4.21.-]
Organism
nla  Neisseria lactamica
Pathway
nla00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:nla00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    NLA_17350
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:nla01002]
    NLA_17350
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:nla01011]
    NLA_17350
Enzymes [BR:nla01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     NLA_17350
   3.4.21  Serine endopeptidases
    3.4.21.-  
     NLA_17350
Peptidases and inhibitors [BR:nla01002]
 Serine peptidases
  Family S13: D-Ala-D-Ala peptidase C family
   NLA_17350
Peptidoglycan biosynthesis and degradation proteins [BR:nla01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   NLA_17350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S13 Beta-lactamase2 Peptidase_S11
Motif
Other DBs
NCBI-ProteinID: CBN87940
UniProt: E4ZF04
LinkDB All DBs
Position
1850914..1852323
Genome map
AA seq 469 aa AA seqDB search
MNFPKTAAFLLLLLASLAAHALDTGRIPQNEIAVYVQELGSGRVVIDHRADVPVNPASTM
KLVTAFAAFKTFGSNYRWATEFKSNGKVSNGTLDGDLYWAGSGDPVFNQENLLDVQKQLR
DKGIRNITGHLILDHKLWGEVGSPDHFEADGGSPFMTPPNPTMLSAGMVMVRAERNAASS
TDILTDPPLPHIFAQNNLKITASQAACPSVKKLMRASFSDNTLKLRGNIPESCLGKPVGV
LMFALDELIRQSFTNHWLLGGGRISDGIGIADTPEGAQTLAVAHAKPMKEILTDMNKRSD
NLIARSVFLKLGGNGKLPAVSEQAASAVRRELAVSGIDVADLVLENGSGLSRKERVTARM
MAQMLETAYFSPFAQDFIDTLPIAGTDGTLRNRFKQSGGLLRLKTGTLNNVRALAGYWLG
DKPMVVVVIINSGRAVSLLPDLDNFVAKNIISGGDGWLDAKLMCKERRA
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgaatttccccaaaacagcggcctttctgctgctgcttctcgcctccctcgccgcacac
gcgctcgataccggccgcattccgcaaaacgaaatcgccgtatatgttcaagaactcggc
agcggcagagtcgtcatcgaccatcgcgcggatgtccccgtcaatcccgcgtctacgatg
aaactcgttaccgcgtttgccgccttcaaaaccttcggcagcaattaccgctgggcgacc
gagtttaaaagcaacggcaaagtgagtaacggcacactggatggcgatttgtattgggca
ggcagcggcgaccccgttttcaatcaggaaaacctgcttgacgttcaaaaacagttgcgc
gacaaaggcatacgcaatatcacgggacacctgatactcgaccacaagctgtggggcgaa
gtcggcagtcccgaccattttgaagccgacggcggctcgccgtttatgactccccccaat
ccgactatgctgtctgccggtatggttatggtgcgcgccgaacgcaatgccgccagcagt
accgacatcctcaccgatccgcctttgccgcatattttcgcccaaaacaacttgaaaatt
accgcctcccaagctgcctgcccttcggtcaaaaaactgatgcgtgcatctttttcggac
aatacgctgaaattgcgtggcaatattcccgaaagctgtttgggcaagcctgtcggtgtc
ctgatgttcgcacttgacgaactgatccggcaaagttttaccaaccactggctgctgggc
ggcggacggatttcagacggcatcggcatagccgacacaccggaaggcgcgcagacgctt
gccgttgcacacgccaaaccgatgaaggaaattttgacggacatgaacaagcgttcggac
aatctgattgcgcgctccgtcttcctcaaactcggcggcaacggcaaactacccgccgtt
tccgaacaggcagcgtctgccgtccggcgcgaacttgccgtgtcaggcatcgatgttgcg
gatttggttttggaaaacggttcgggtctgtccagaaaagaaagggtaacggcgagaatg
atggcgcaaatgttggaaacggcttatttcagcccgtttgcacaagatttcatcgacacg
ctgcccatcgccggcacagacgggactttacgcaaccgcttcaaacaaagcggcgggctg
ctgcgcctgaaaaccggcacgctcaacaatgtccgcgcccttgcaggttattggctgggc
gacaaaccgatggtggtggtcgtcatcatcaacagcgggcgcgccgtttccctgctgcct
gatttggacaacttcgttgccaaaaacatcatctccggcggcgacggctggctggatgcg
aaactgatgtgcaaagaacgccgcgcctga

DBGET integrated database retrieval system