KEGG   Nitrosospira lacus: EBAPG3_001970Help
Entry
EBAPG3_001970     CDS       T04907                                 

Definition
(GenBank) ribulose bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
nlc  Nitrosospira lacus
Pathway
nlc00630  Glyoxylate and dicarboxylate metabolism
nlc01100  Metabolic pathways
nlc01110  Biosynthesis of secondary metabolites
nlc01120  Microbial metabolism in diverse environments
nlc01130  Biosynthesis of antibiotics
nlc01200  Carbon metabolism
Module
nlc_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:nlc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    EBAPG3_001970
Enzymes [BR:nlc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     EBAPG3_001970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: ARO86643
UniProt: A0A1W6SLH1
LinkDB All DBs
Position
complement(444161..444595)
Genome map
AA seq 144 aa AA seqDB search
MMTNVGNRITQGQFSFLPPLTDKQISAQIKYALKNNWAIGIEYTDDPHPRNTYWEMFGNP
MFDLKDPAGILSEINDCRKTYPNHYIRVTAFNSTRGVESPTMSYIVNRPKTEPGFGLVRQ
EVEGRSIRYTIHSYATDKAESERY
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgatgaccaatgtaggaaatcgcatcacgcaggggcaattctctttcctgccgccactg
acggataaacaaatttccgcacaaatcaaatatgcgttgaaaaacaattgggcgataggt
atcgagtacaccgacgatccccacccgcgcaatacgtattgggaaatgttcggcaatccg
atgtttgacttgaaagatcccgccgggatcctgtcggaaatcaatgactgccgcaaaact
tatccgaatcattatatccgggtaaccgcatttaactcgacgcgcggggtggaaagtccg
actatgtcgtatatcgtcaaccgtccgaagacagaaccgggctttggcctggtacgccag
gaagtggaaggccgtagcattcgttacaccattcattcctacgcaactgacaaagcggaa
tccgaacggtattaa

DBGET integrated database retrieval system