KEGG   Nitrosospira lacus: EBAPG3_003725Help
Entry
EBAPG3_003725     CDS       T04907                                 

Definition
(GenBank) Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase GatCAB subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
nlc  Nitrosospira lacus
Pathway
nlc00970  Aminoacyl-tRNA biosynthesis
nlc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nlc00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    EBAPG3_003725
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:nlc03029]
    EBAPG3_003725
Enzymes [BR:nlc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     EBAPG3_003725
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     EBAPG3_003725
Mitochondrial biogenesis [BR:nlc03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    EBAPG3_003725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: ARO89007
UniProt: A0A1W6ST75
LinkDB All DBs
Position
837205..838659
Genome map
AA seq 484 aa AA seqDB search
MLNFGVTQLSALLAARKISSTELTREFLERSKSLNPDYNAFITIDEETSLAQARAADAMI
AAGQAHPLTGIPIAQKDIFCTKGWLTTCGSRMLSNFISPYDAHVIERFNAAGAVNIGKTN
MDEFAMGSSNETSFYGPVKNPWDSTAVPGGSSGGSACAVAARMAPAATGTDTGGSIRQPA
ALCGISGIKPTYGLVSRYGMIAFASSLDQGGPMAKSAEDLALMLNVMTGFDARDSTSLQR
EPEDYTRNLEKPLEGLRVGLPKEYFVKEINADVARAVDAAIAEYSKLGAKTVEVSLPSTK
LSVPVYYVLAPAEASSNLSRFDGVRYGYRAPEYVDLNDMYRKSRAQGFGAEVKRRILIGT
YVLSHGYYDAYYIQAQKLRRLIAQDFIEAFKQCDIIMGPTSPTVAFNLGEKSSDPVQMYL
SDAYTIAVNLAGLPAMSIPAGFGNQNRPVGLHIIGNYFAEAQMLNVAHQYQRATDWHIRM
PIPL
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgttgaacttcggcgtcacgcaactctctgccttgcttgcggcaagaaaaatctccagc
actgaactgaccagggagtttcttgagcgctcaaagtcactgaatccggactacaacgct
ttcattactatcgatgaagagacaagccttgcccaggcacgagccgccgatgcgatgatc
gcggccggccaggcgcatccgctaaccggcattcccattgcccagaaggatattttctgt
accaagggatggcttaccacctgtggatcgcggatgctgtcgaactttatttcgccttac
gatgcccacgtgatcgagcgtttcaatgcggccggggcagtgaatatcggcaaaaccaat
atggatgaattcgccatggggtcgagcaacgaaacctccttttatggaccggtgaaaaat
ccatgggatagtacggccgtcccgggcggcagttctggcggctcggcctgtgccgtcgcc
gcgcgcatggctcccgccgcgaccggcaccgatacgggcggttcaatccgtcagcccgcg
gcgctatgcggaatctcaggcatcaagcccacttatggactggtatcgcgctacggcatg
atcgcgtttgcttccagcctcgaccagggcggacccatggcgaaatcagcggaagatctg
gcgttaatgctgaatgtcatgacaggattcgatgcgcgcgattcgaccagtctgcagcgc
gagccggaagattacacgcgcaatctggaaaagccgctggagggcttgcgtgttggtttg
ccgaaggaatatttcgtcaaggaaataaacgctgatgtagcgcgtgccgtggacgcggcc
atcgccgaatacagcaagctgggtgccaagacagtagaggtgtcgctgccttccacgaaa
ctctccgtgcctgtttattacgtactggccccggcagaggcatcgagtaacctctcgcgt
ttcgatggcgtgcgttatggctatcgtgctccggaatatgtagacctcaacgacatgtat
cgcaaaagccgtgcccagggtttcggcgcggaagtgaagcgccgcattctgattggcacg
tatgtgctatcgcacgggtactatgacgcgtactatattcaggcacagaaactgcgccgt
ctgattgcacaggattttatcgaggcattcaaacagtgcgacatcatcatgggacccaca
tcgcccacggtcgcgttcaatctgggagagaaaagcagcgatccggtacagatgtattta
tccgatgcctacaccatcgcggttaaccttgccggattgccagccatgtccattcctgca
ggttttggcaaccaaaacaggccggtgggattacacattatcggcaattattttgcggaa
gcgcaaatgctgaatgtggctcaccaataccagcgggcgaccgattggcatattcgcatg
cctattccactatag

DBGET integrated database retrieval system