KEGG   Nitrosospira lacus: EBAPG3_006400Help
Entry
EBAPG3_006400     CDS       T04907                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
nlc  Nitrosospira lacus
Pathway
nlc00020  Citrate cycle (TCA cycle)
nlc00270  Cysteine and methionine metabolism
nlc00620  Pyruvate metabolism
nlc00630  Glyoxylate and dicarboxylate metabolism
nlc00680  Methane metabolism
nlc01100  Metabolic pathways
nlc01110  Biosynthesis of secondary metabolites
nlc01120  Microbial metabolism in diverse environments
nlc01130  Biosynthesis of antibiotics
nlc01200  Carbon metabolism
Module
nlc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nlc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
nlc_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:nlc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    EBAPG3_006400
   00620 Pyruvate metabolism
    EBAPG3_006400
   00630 Glyoxylate and dicarboxylate metabolism
    EBAPG3_006400
  09102 Energy metabolism
   00680 Methane metabolism
    EBAPG3_006400
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    EBAPG3_006400
Enzymes [BR:nlc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     EBAPG3_006400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_N Ldh_1_C
Motif
Other DBs
NCBI-ProteinID: ARO87436
UniProt: A0A1W6SNS2
LinkDB All DBs
Position
1438615..1439598
Genome map
AA seq 327 aa AA seqDB search
MKPPIRIAVTGAAGQIGYSLLFRIAAGDMLGNDQPVFLQLLDIPRLLPSLKGVMMELEDC
AFPLLAGVIATDDPNTAFRDISIAMLVGARPRGKGMERKDLLEANGAIFTTQGRALDEVA
RRDVKVLIVGNPANTNAYIAMKNAPGLKPENFSAMMRLDHNRALSQIAAKVGQPVSSIRK
VIIWGNHSATQYPDLNHAETDGNKISLLINDPAWIEDYFIPTVQKRGAVVIEARGSSSAA
SAANAAINHVRDWVLGTRENDWISMGIPSDGSYGIPEGVIYGYPVTCRDGVYRIVPDLEI
SEFSQAKMQATYGELVEERDSVKHLLG
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgaagccccccattcgtatcgccgtcacgggcgccgccggccagatcggctacagtttg
ctgtttcgcatcgccgcaggcgacatgcttggcaacgatcagcctgtttttctgcaattg
ctcgacatacccaggttgctgccttcgctcaagggagtaatgatggaactggaggactgc
gcattcccgctactggctggcgtaatcgccacggatgatcccaacaccgctttccgtgac
attagcatcgcgatgctggtgggcgcccgtccacgcggcaagggcatggagcgtaaagac
ctgctggaagcgaatggggcgatatttaccacccagggcagggcactggatgaagtagcc
cgccgtgatgtcaaggttctgatagtgggcaatcccgccaataccaatgcttacatcgcg
atgaaaaacgctcccggcctgaagccggaaaacttctcggcaatgatgcggctggaccac
aatcgcgccctgtcgcaaattgccgctaaagtcgggcaaccggtttccagcatcagaaaa
gtaatcatctggggtaatcactccgctacacaatatcccgacctgaatcatgccgagact
gacggcaacaaaatctcccttcttatcaacgatcctgcatggatagaagactatttcatc
cccaccgtacaaaaacgcggtgcagtggtaatcgaagcgcgcggctcgtcaagtgccgcc
agcgcggcgaatgccgccatcaatcatgttcgtgactgggttttgggtacgcgggaaaat
gactggatatccatgggaataccatcggatggcagctatggcattcccgagggcgttatc
tacggctatccggtaacctgccgggatggggtctaccgaatcgtccctgacctggagata
agcgaattcagccaagcgaaaatgcaggcgacctacggggaattggtggaagagcgggac
tctgtcaaacatctgcttggataa

DBGET integrated database retrieval system