KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100579257Help
Entry
100579257         CDS       T03265                                 

Gene name
IL9
Definition
(RefSeq) interleukin-9
  KO
K05432  interleukin 9
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04060  Cytokine-cytokine receptor interaction
nle04630  Jak-STAT signaling pathway
nle05310  Asthma
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    100579257 (IL9)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100579257 (IL9)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    100579257 (IL9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:nle04052]
    100579257 (IL9)
Cytokines and growth factors [BR:nle04052]
 Cytokines
  Interleukins
   100579257 (IL9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL7
Motif
Other DBs
NCBI-GeneID: 100579257
NCBI-ProteinID: XP_003266458
Ensembl: ENSNLEG00000008279
UniProt: G1RA44
LinkDB All DBs
Position
2
AA seq 144 aa AA seqDB search
MLLAVVLTSALLLCSVAGQGCPTLTGIMNINFLINKIQEDPASKCHCSANVTSCLCLPIP
SDNCTRPCFSEGLSQMTNTTVQTRYPLIFNRVKKSVEVLKNNKCPYFSCEQPCNQTTAGN
TLTFLKNLLEIFQKEKMRGMGGKI
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgcttctggccgtggtccttacctctgccctgctgctgtgctccgtggcaggccagggc
tgtccaaccttgacagggatcatgaacatcaacttcctcatcaacaagatacaggaagat
ccagcttcgaagtgccactgcagtgctaatgtgaccagttgtctctgtctgcccattcct
tctgacaactgcaccagaccatgcttcagtgagggactgtctcagatgaccaataccacc
gtgcaaacaagatacccactgattttcaatcgggtgaaaaaatcggttgaagtcctaaag
aacaacaagtgtccatatttttcctgtgaacagccatgcaaccaaaccacggcaggcaac
acactgacatttctgaagaatcttctggaaattttccagaaagaaaagatgagaggaatg
ggaggcaaaatatga

DBGET integrated database retrieval system