KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100579454
Entry
100579454         CDS       T03265                                 

Gene name
AIM2
Definition
(RefSeq) interferon-inducible protein AIM2 isoform X1
  KO
K12966  absent in melanoma 2
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04621  NOD-like receptor signaling pathway
nle04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:nle00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100579454 (AIM2)
   04623 Cytosolic DNA-sensing pathway
    100579454 (AIM2)
SSDB
Motif
Pfam: HIN PYRIN tRNA_anti-codon
Other DBs
NCBI-GeneID: 100579454
NCBI-ProteinID: XP_003258726
Ensembl: ENSNLEG00000013170
LinkDB
Position
12
AA seq 346 aa
MESKYKEILLLTGLDNITDEELDRFKFFLSDEFNIATGKLHTANRIQVANLMIQNAGAVS
AVMKTIHIFQKLNYMLLANRLQEEKEKVDKKYKSVTKPKPLSQAEMSPAASAAIRNDVAK
QRAAPKVSPHVKPEQKQMVVQQESIREGFQKGCLPVMVLKAMKPFTFETQEGKQEMFHAT
VATEKEFFLVKVFNTLLKDKFIPKRIIIISRYYRHSGFLEVNSTSRVLDAESDQKVNVPL
NIIRKAGETPKISTLQTQPLGTIVNGLFVVQKVTEKKKNVLFDLSDNTGKMEVLVIRNED
AMKCKEGDKVRLTFFTLSKNGEKLQLTSGVHSTIKVIKAKKKNREK
NT seq 1041 nt   +upstreamnt  +downstreamnt
atggagagtaaatacaaggagatactcttgctaacgggcctggataacatcaccgatgag
gaactggataggtttaagttctttctttcggatgagtttaatatcgccacaggcaaacta
catactgcaaacagaatacaagtagctaacttgatgattcaaaatgctggtgcggtgtct
gcagtgatgaagaccattcacatttttcagaagttgaattatatgcttttggcaaaccgt
cttcaggaagagaaggaaaaagttgataagaaatacaaatcggtaacaaaaccaaagcca
ctaagtcaagctgaaatgagtcctgctgcatctgcagccatcagaaatgatgtcgcaaag
caacgtgctgcaccaaaagtctctcctcatgttaagcctgaacagaaacagatggtggtc
cagcaggaatctatcagagaagggtttcagaaaggctgtttgccagttatggtactgaaa
gcaatgaagcccttcacgtttgagacccaagaaggcaagcaagagatgtttcatgctaca
gtggctacagaaaaagaattcttccttgtaaaagtttttaatacactgctaaaagataaa
ttcattccaaagagaataattataatatcaagatattatcggcacagtggtttcttagag
gtaaatagcacctcacgtgtgttagatgctgaatctgaccaaaaggttaatgtcccgctg
aacattatcagaaaagctggtgaaaccccgaagatcagcacgcttcaaactcagcccctc
ggaacaattgtgaatggtttgtttgtagtccagaaggtaacagaaaagaagaaaaacgta
ttatttgacctaagtgacaacactgggaaaatggaagtactggtgattagaaacgaggac
gcaatgaaatgtaaggaaggagataaggttcgacttacattcttcacactgtcaaaaaat
ggagaaaaactacagctgacatctggagttcatagcaccataaaggttattaaggccaaa
aaaaaaaacagagagaaataa

DBGET integrated database retrieval system