KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100579580
Entry
100579580         CDS       T03265                                 

Gene name
WNT7B
Definition
(RefSeq) protein Wnt-7b isoform X1
  KO
K00572  wingless-type MMTV integration site family, member 7
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04150  mTOR signaling pathway
nle04310  Wnt signaling pathway
nle04390  Hippo signaling pathway
nle04550  Signaling pathways regulating pluripotency of stem cells
nle04916  Melanogenesis
nle04934  Cushing syndrome
nle05010  Alzheimer disease
nle05022  Pathways of neurodegeneration - multiple diseases
nle05165  Human papillomavirus infection
nle05200  Pathways in cancer
nle05205  Proteoglycans in cancer
nle05217  Basal cell carcinoma
nle05224  Breast cancer
nle05225  Hepatocellular carcinoma
nle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100579580 (WNT7B)
   04390 Hippo signaling pathway
    100579580 (WNT7B)
   04150 mTOR signaling pathway
    100579580 (WNT7B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100579580 (WNT7B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100579580 (WNT7B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100579580 (WNT7B)
   05205 Proteoglycans in cancer
    100579580 (WNT7B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100579580 (WNT7B)
   05226 Gastric cancer
    100579580 (WNT7B)
   05217 Basal cell carcinoma
    100579580 (WNT7B)
   05224 Breast cancer
    100579580 (WNT7B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100579580 (WNT7B)
   05022 Pathways of neurodegeneration - multiple diseases
    100579580 (WNT7B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100579580 (WNT7B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100579580 (WNT7B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:nle00536]
    100579580 (WNT7B)
Glycosaminoglycan binding proteins [BR:nle00536]
 Heparan sulfate / Heparin
  Morphogens
   100579580 (WNT7B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100579580
NCBI-ProteinID: XP_030671232
Ensembl: ENSNLEG00000013688
LinkDB
Position
7b
AA seq 356 aa
MAQPPSLDHAQKLSQVDFLRVSLLWRPVREARSTVIRGGPGSQHHLQQDSWPSPAAACHL
PEPARCHHCDRGGGADGHQRVPVPVPLWTLELLCPRREDRLRARAPRSREAAFTYAITAA
GVAHAVTAACSQGNLSNCGCDREKQGYYNQAEGWKWGGCSADVRYGIDFSRRFVDAREIK
KNARRLMNLHNNEAGRKVLEDRMQLECKCHGVSGSCTTKTCWTTLPKFREVGHLLKEKYN
AAVQVEVVRASRLRQPTFLRIKQLRSYQKPMETDLVYIEKSPNYCEEDAATGSVGTQGRL
CNRTSPGADGCDTMCCGRGYNTHQYTKVWQCNCKFHWCCFVKCNTCSERTEVFTCK
NT seq 1071 nt   +upstreamnt  +downstreamnt
atggcgcagcccccctccctggatcatgcacagaaactttcgcaagtggattttctacgt
gtttctctgctttggcgtcctgtacgtgaagctcggagcactgtcatccgtggtggccct
gggagccaacatcatctgcaacaagattcctggcctagccccgcggcagcgtgccatctg
ccagagccggcccgatgccatcattgtgatcggggagggggcgcagatgggcatcaacga
gtgccagtaccagttccgctttggacgctggaactgctctgccctcggcgagaagaccgt
cttcgggcaagagctccgaggagccgtgaggctgccttcacgtacgccatcaccgcggct
ggcgtagcgcacgccgtcaccgctgcctgcagccaaggcaacctgagcaactgcggctgc
gaccgcgagaagcagggctactacaaccaagccgagggctggaagtggggtggctgctcg
gccgacgtgcgttacggcatcgacttctcccggcgcttcgtggacgctcgggagatcaag
aagaacgcgcggcgcctcatgaacctgcataacaatgaggccggcaggaaggttctagag
gaccggatgcagctggagtgcaagtgccacggcgtgtctggctcctgcaccaccaagacc
tgctggaccacgctgcccaagttccgagaggtgggccacctgctgaaggagaagtacaac
gcggccgtgcaggtggaggtggtgcgggccagccgtctgcggcagcccaccttcctgcgc
atcaaacagctgcgcagctatcagaagcccatggagacggacctggtgtacattgagaag
tcgcccaactactgcgaggaggacgcggccacgggcagcgtgggcacgcagggccgtctc
tgcaaccgcacgtcgcccggcgcagacggctgtgacaccatgtgctgcggccgaggctac
aacacccaccagtacaccaaggtgtggcagtgcaactgcaaattccactggtgctgcttc
gtcaagtgcaacacctgcagcgagcgcaccgaggtcttcacctgcaagtga

KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100586052
Entry
100586052         CDS       T03265                                 

Gene name
WNT8A
Definition
(RefSeq) protein Wnt-8a isoform X2
  KO
K00714  wingless-type MMTV integration site family, member 8
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04150  mTOR signaling pathway
nle04310  Wnt signaling pathway
nle04390  Hippo signaling pathway
nle04550  Signaling pathways regulating pluripotency of stem cells
nle04916  Melanogenesis
nle04934  Cushing syndrome
nle05010  Alzheimer disease
nle05022  Pathways of neurodegeneration - multiple diseases
nle05165  Human papillomavirus infection
nle05200  Pathways in cancer
nle05205  Proteoglycans in cancer
nle05217  Basal cell carcinoma
nle05224  Breast cancer
nle05225  Hepatocellular carcinoma
nle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100586052 (WNT8A)
   04390 Hippo signaling pathway
    100586052 (WNT8A)
   04150 mTOR signaling pathway
    100586052 (WNT8A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100586052 (WNT8A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100586052 (WNT8A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100586052 (WNT8A)
   05205 Proteoglycans in cancer
    100586052 (WNT8A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100586052 (WNT8A)
   05226 Gastric cancer
    100586052 (WNT8A)
   05217 Basal cell carcinoma
    100586052 (WNT8A)
   05224 Breast cancer
    100586052 (WNT8A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100586052 (WNT8A)
   05022 Pathways of neurodegeneration - multiple diseases
    100586052 (WNT8A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100586052 (WNT8A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100586052 (WNT8A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:nle00536]
    100586052 (WNT8A)
Glycosaminoglycan binding proteins [BR:nle00536]
 Heparan sulfate / Heparin
  Morphogens
   100586052 (WNT8A)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100586052
NCBI-ProteinID: XP_003266478
Ensembl: ENSNLEG00000008659
UniProt: A0A2I3GZJ6
LinkDB
Position
2
AA seq 351 aa
MGNLFMLWAALGICCAAFSASAWSVNNFLITGPKAYLTYTTSVALGAQSGIEECKFQFAW
ERWNCPENALQLSTHNRLRSATRETSFIHAISSAGVMYIITKNCSMGDFENCGCDGSKNG
KTGGHGWIWGGCSDNVEFGERISKLFVDSLEKGKDARALMNLHNNRAGRLAVRATMKRTC
KCHGISGSCSIQTCWLQLADFREMGDYLKAKYDQALKIEMDKRQLRAGNSAEGHWVPAEA
FLPSAEAELIFLEESPDYCTCNSSLGIYGTEGRECLQNSHNTSRWERRSCGRLCTECGLQ
VEERKTEVISSCNCKFQWCCTVKCDQCRHVVSKYYCARSPGSAQSLGKGSA
NT seq 1056 nt   +upstreamnt  +downstreamnt
atggggaacctgtttatgctctgggcagctctgggcatatgctgtgctgcattcagtgcc
tctgcctggtcagtgaacaatttcctgataacaggtcccaaggcctatctgacctacacg
actagcgtggccttgggtgcccagagtggcatcgaggagtgcaagttccagtttgcttgg
gaacgctggaactgccctgaaaatgctcttcagctctccacccacaaccggctgagaagt
gctaccagagagacttccttcatacatgctatcagctctgctggagtcatgtacatcatc
accaagaactgtagcatgggtgacttcgaaaactgtggctgtgatgggtcaaaaaatgga
aaaacaggaggccatggctggatctggggaggctgcagtgacaatgtggaatttggggaa
aggatctccaaactctttgtggacagtctggagaaggggaaggatgccagagccctgatg
aatcttcacaacaacagggccggcagactggcagtgagagccaccatgaaaaggacgtgc
aaatgtcatggcatctctgggagctgcagtatacagacgtgctggctgcagctggctgac
ttccgggagatgggagactacctaaaggccaagtatgaccaggcgttgaaaattgaaatg
gataagcggcagctgagagctgggaacagcgccgagggccactgggtgcccgctgaggcc
ttccttcctagcgcagaggcggaactgatctttttagaggaatcaccagattactgtacc
tgcaattccagcctgggcatctatggcacagagggtcgtgagtgcctacagaacagccac
aacacatccaggtgggagcgacgtagctgtgggcgcctgtgcactgagtgtgggctgcag
gtggaagagaggaaaactgaggtcataagcagctgtaactgcaaattccagtggtgctgt
acggtcaagtgtgaccagtgtaggcatgtggtgagcaagtattactgtgcacgctcccca
ggcagtgcccagtccctgggtaagggcagtgcctga

KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100587307
Entry
100587307         CDS       T03265                                 

Gene name
WNT1
Definition
(RefSeq) proto-oncogene Wnt-1
  KO
K03209  wingless-type MMTV integration site family, member 1
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04150  mTOR signaling pathway
nle04310  Wnt signaling pathway
nle04390  Hippo signaling pathway
nle04550  Signaling pathways regulating pluripotency of stem cells
nle04916  Melanogenesis
nle04934  Cushing syndrome
nle05010  Alzheimer disease
nle05022  Pathways of neurodegeneration - multiple diseases
nle05165  Human papillomavirus infection
nle05200  Pathways in cancer
nle05205  Proteoglycans in cancer
nle05217  Basal cell carcinoma
nle05224  Breast cancer
nle05225  Hepatocellular carcinoma
nle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100587307 (WNT1)
   04390 Hippo signaling pathway
    100587307 (WNT1)
   04150 mTOR signaling pathway
    100587307 (WNT1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100587307 (WNT1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100587307 (WNT1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100587307 (WNT1)
   05205 Proteoglycans in cancer
    100587307 (WNT1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100587307 (WNT1)
   05226 Gastric cancer
    100587307 (WNT1)
   05217 Basal cell carcinoma
    100587307 (WNT1)
   05224 Breast cancer
    100587307 (WNT1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100587307 (WNT1)
   05022 Pathways of neurodegeneration - multiple diseases
    100587307 (WNT1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100587307 (WNT1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100587307 (WNT1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:nle00536]
    100587307 (WNT1)
Glycosaminoglycan binding proteins [BR:nle00536]
 Heparan sulfate / Heparin
  Morphogens
   100587307 (WNT1)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100587307
NCBI-ProteinID: XP_030672510
LinkDB
Position
8
AA seq 370 aa
MGLWALLPGWVSATLLLALAALPAALAANSSGRWWGIVNVASSTNLLTDSKSLQLVLEPS
LQLLSRKQRRLIRQNPGILHSVSGGLQSAVRECKWQFRNRRWNCPTAPGPHLFGKIVNRG
CRETAFIFAITSAGVTHSVARSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFGRLF
GREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTVRTCWMRLPTLR
AVGDVLRDRFDGASRVLYGNRGSNRASRAELLRLEPEDPAHKPPSPHDLVYFEKSPNFCT
YSGRLGTAGTAGRACNSSSPALDGCELLCCGRGHRTRTQRVTERCNCTFHWCCHVSCRNC
THTRVLHECL
NT seq 1113 nt   +upstreamnt  +downstreamnt
atggggctctgggcgctgttgcctggctgggtttctgctacgctgctgctggcgctggcc
gctctgcccgcagccctggctgccaacagcagtggccgatggtggggtattgtgaacgta
gcctcctccacgaacctgctgacggactccaagagtctgcaactggtactcgagcccagt
ctgcagctgttgagccgcaaacagcggcgtctgatacgccaaaatccggggatcctgcac
agcgtgagtggggggctgcagagtgccgtgcgcgagtgcaagtggcagttccggaatcgc
cgctggaactgtcccactgctccagggccccacctcttcggcaagatcgtcaaccgaggc
tgtcgagaaacggcgtttatcttcgctatcacatccgccggggtcacccattcggtggcg
cgctcctgctcagagggttccatcgaatcttgcacgtgtgactaccggcggcgcggcccc
gggggccccgactggcactggggtggctgcagcgacaacattgacttcggccgcctcttc
ggccgggagttcgtggactccggggagaaggggcgggacctgcgcttcctcatgaacctt
cacaacaacgaggcaggccgtacgaccgtattctccgagatgcgccaggagtgcaagtgc
cacgggatgtccggttcgtgcacggtgcgcacgtgctggatgcggctgcccacgctgcgc
gccgtgggcgatgtgctgcgcgaccgcttcgacggcgcctcgcgcgtcctctacggcaac
cgcggcagcaaccgcgcttcgcgggcggagctgctgcgcctggagccggaagacccggcc
cacaaaccgccctccccccacgacctcgtctacttcgagaaatcgcccaacttctgcacg
tacagcggacgcctgggtacagcgggcacggcagggcgcgcctgtaacagctcgtcgccc
gcgctggacggctgcgagctgctctgctgcggcaggggccaccgcacgcgcacgcagcgc
gtcaccgagcgctgcaactgcaccttccactggtgctgccacgtcagctgccgcaactgc
acgcacacgcgcgtactgcacgagtgtctgtga

KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100587640
Entry
100587640         CDS       T03265                                 

Gene name
WNT10B
Definition
(RefSeq) protein Wnt-10b
  KO
K01357  wingless-type MMTV integration site family, member 10
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04150  mTOR signaling pathway
nle04310  Wnt signaling pathway
nle04390  Hippo signaling pathway
nle04550  Signaling pathways regulating pluripotency of stem cells
nle04916  Melanogenesis
nle04934  Cushing syndrome
nle05010  Alzheimer disease
nle05022  Pathways of neurodegeneration - multiple diseases
nle05165  Human papillomavirus infection
nle05200  Pathways in cancer
nle05205  Proteoglycans in cancer
nle05217  Basal cell carcinoma
nle05224  Breast cancer
nle05225  Hepatocellular carcinoma
nle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100587640 (WNT10B)
   04390 Hippo signaling pathway
    100587640 (WNT10B)
   04150 mTOR signaling pathway
    100587640 (WNT10B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100587640 (WNT10B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100587640 (WNT10B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100587640 (WNT10B)
   05205 Proteoglycans in cancer
    100587640 (WNT10B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100587640 (WNT10B)
   05226 Gastric cancer
    100587640 (WNT10B)
   05217 Basal cell carcinoma
    100587640 (WNT10B)
   05224 Breast cancer
    100587640 (WNT10B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100587640 (WNT10B)
   05022 Pathways of neurodegeneration - multiple diseases
    100587640 (WNT10B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100587640 (WNT10B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100587640 (WNT10B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:nle00536]
    100587640 (WNT10B)
Glycosaminoglycan binding proteins [BR:nle00536]
 Heparan sulfate / Heparin
  Morphogens
   100587640 (WNT10B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100587640
NCBI-ProteinID: XP_030672507
LinkDB
Position
8
AA seq 389 aa
MLEEPRPRPPPSGLAGLLFLVLCSRALSNEILGLKLPGEPPLTANTVCLTLSGLSKRQLG
LCLRNPDVTASALQGLHIAVHECQHQLRDQRWNCSALEGGGRLPHHSAILRRGFRESAFS
FSMLAAGVMHAVATACSLGKLVSCGCGWKGSGEQDRLRAKLLQLQALSRGKSFPHSLPSP
GPGSSPSPGPQDTWEWGGCNHDMDFGEKFSRDFLDSREAPRDIQARMRIHNNRVGRQVVT
ENLKRKCKCHGTSGSCQFKTCWRAAPEFRAVGAALRERLGRAIFIDTHNRNSGAFQPRLR
PRRLSGELVYFERSPDFCERDPTMGSPGTRGRACNKTSRLLDGCGSLCCGRGHNVLRQTR
VERCHCRFHWCCYVLCDECKVTEWVNVCK
NT seq 1170 nt   +upstreamnt  +downstreamnt
atgctggaggagccccggccgcggcctccgccctcgggcctcgcgggtctcctgttcctg
gtgttgtgcagtcgggctctaagcaatgagattctgggcctgaagttgcctggcgagccg
ccgctgacggccaacaccgtgtgcttgacgctgtccggcctgagcaagcggcagctaggc
ctgtgcctgcgcaaccccgacgtgacggcgtccgcgcttcagggtctgcacatcgcggtc
cacgagtgtcagcaccagctgcgcgaccagcgctggaactgctccgcgctcgagggcggt
ggccgcctgccgcaccacagcgccatcctcaggcgcggtttccgagaaagtgctttttcc
ttctccatgctggctgctggggtcatgcacgcagtagccacagcctgcagcctgggcaag
ctggtgagctgtggctgtggctggaagggcagtggtgagcaggatcggctgagggccaaa
ctgctgcagctgcaggcactgtcccgaggcaagagtttcccccactctctgcccagccct
ggccctggctcaagccccagccctggcccccaggacacatgggaatggggtggctgtaac
catgacatggactttggagagaagttctctcgggatttcttggattccagggaagctccc
cgggacatccaggcacgaatgcgaatccacaacaacagggtggggcgtcaggtggtaact
gaaaacctgaagcggaaatgcaagtgtcatggcacgtcaggcagctgccagttcaagaca
tgctggagggcggccccagagttccgggcagtgggggcagcgttgagggagcggctgggc
cgggccatcttcattgatacacacaaccgcaattctggagccttccagccccgtctgcgt
ccccgtcgcctctcaggagagctggtctactttgagaggtctcctgacttctgtgagcga
gaccccactatgggctccccagggacaaggggccgggcctgcaacaagaccagccgcctg
ttggatggctgtggcagcttgtgctgtggccgtgggcacaacgtgctccggcagacacgg
gttgagcgctgccattgccgcttccactggtgctgctatgtgctgtgtgatgagtgcaag
gttacagagtgggtgaatgtgtgtaagtga

KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100593900
Entry
100593900         CDS       T03265                                 

Gene name
WNT7A
Definition
(RefSeq) protein Wnt-7a
  KO
K00572  wingless-type MMTV integration site family, member 7
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04150  mTOR signaling pathway
nle04310  Wnt signaling pathway
nle04390  Hippo signaling pathway
nle04550  Signaling pathways regulating pluripotency of stem cells
nle04916  Melanogenesis
nle04934  Cushing syndrome
nle05010  Alzheimer disease
nle05022  Pathways of neurodegeneration - multiple diseases
nle05165  Human papillomavirus infection
nle05200  Pathways in cancer
nle05205  Proteoglycans in cancer
nle05217  Basal cell carcinoma
nle05224  Breast cancer
nle05225  Hepatocellular carcinoma
nle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100593900 (WNT7A)
   04390 Hippo signaling pathway
    100593900 (WNT7A)
   04150 mTOR signaling pathway
    100593900 (WNT7A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100593900 (WNT7A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100593900 (WNT7A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100593900 (WNT7A)
   05205 Proteoglycans in cancer
    100593900 (WNT7A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100593900 (WNT7A)
   05226 Gastric cancer
    100593900 (WNT7A)
   05217 Basal cell carcinoma
    100593900 (WNT7A)
   05224 Breast cancer
    100593900 (WNT7A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100593900 (WNT7A)
   05022 Pathways of neurodegeneration - multiple diseases
    100593900 (WNT7A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100593900 (WNT7A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100593900 (WNT7A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:nle00536]
    100593900 (WNT7A)
Glycosaminoglycan binding proteins [BR:nle00536]
 Heparan sulfate / Heparin
  Morphogens
   100593900 (WNT7A)
SSDB
Motif
Pfam: wnt COG6
Other DBs
NCBI-GeneID: 100593900
NCBI-ProteinID: XP_030657593
LinkDB
Position
21
AA seq 349 aa
MNRKARRCLGHLFLSLGMVYLRIGGFSSVVALGASIICNKIPGLAPRQRAICQSRPDAII
VIGEGSQMGLDECQFQFRNGRWNCSALGERTVFGKELKVGSREAAFTYAIIAAGVAHAIT
AACTQGNLSDCGCDKEKQGQYHRDEGWKWGGCSADIRYGIGFAKVFVDAREIKQNARTLM
NLHNNEAGRKILEENMKLECKCHGVSGSCTTKTCWTTLPQFRELGYVLKDKYNEAVHVEP
VRASRNKRPTFLKIKKPLSYRKPMDTDLVYIEKSPNYCEEDPVTGSVGTQGRACNKTAPQ
ASGCDLMCCGRGYNTHQYARVWQCNCKFHWCCYVKCNTCSERTEMYTCK
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgaaccggaaagcgcggcgctgcctgggccacctctttctcagcctgggcatggtctac
ctccggatcggcggcttctcctcagtggtagctctgggcgcaagcatcatctgtaacaag
atcccaggcctggctcccagacagcgggcgatctgccagagccggcccgacgccatcatc
gtcataggagaaggctcgcaaatgggcctggacgagtgtcagtttcagttccgcaatggc
cgctggaactgctctgcactgggagagcgcaccgtctttgggaaggagctcaaagtgggg
agccgggaggctgcattcacctacgccatcattgccgccggcgtggcccacgccatcaca
gctgcctgtacccagggcaacctgagcgactgtggctgcgacaaagagaagcaaggccag
taccaccgggacgagggctggaagtggggtggctgctctgccgacatccgctacggcatc
ggcttcgccaaggtctttgtggatgcccgggagatcaagcagaatgcccggactctcatg
aacttgcacaataacgaggcaggccgaaagatcctggaggagaacatgaagctggaatgt
aagtgccacggcgtgtcaggctcgtgcaccaccaagacgtgctggaccacactgccacag
tttcgggagctaggctacgtgctcaaggacaagtacaacgaggccgttcacgtggagcct
gtgcgtgccagccgcaacaagcggcccaccttcctgaagatcaagaagccactgtcgtac
cgcaagcccatggacacggacctggtgtacatcgagaagtcgcccaactactgcgaggag
gacccggtgaccggcagtgtgggcacccagggccgcgcctgcaacaagacggctccccag
gccagcggctgtgacctcatgtgctgtgggcgtggctacaacacccaccagtacgcccgc
gtgtggcagtgcaactgtaagttccactggtgctgctatgtcaagtgcaacacgtgcagc
gagcgcacggagatgtacacgtgcaagtga

KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100594864
Entry
100594864         CDS       T03265                                 

Gene name
WNT11
Definition
(RefSeq) protein Wnt-11
  KO
K01384  wingless-type MMTV integration site family, member 11
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04150  mTOR signaling pathway
nle04310  Wnt signaling pathway
nle04390  Hippo signaling pathway
nle04550  Signaling pathways regulating pluripotency of stem cells
nle04916  Melanogenesis
nle04934  Cushing syndrome
nle05010  Alzheimer disease
nle05022  Pathways of neurodegeneration - multiple diseases
nle05165  Human papillomavirus infection
nle05200  Pathways in cancer
nle05205  Proteoglycans in cancer
nle05217  Basal cell carcinoma
nle05224  Breast cancer
nle05225  Hepatocellular carcinoma
nle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100594864 (WNT11)
   04390 Hippo signaling pathway
    100594864 (WNT11)
   04150 mTOR signaling pathway
    100594864 (WNT11)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100594864 (WNT11)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100594864 (WNT11)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100594864 (WNT11)
   05205 Proteoglycans in cancer
    100594864 (WNT11)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100594864 (WNT11)
   05226 Gastric cancer
    100594864 (WNT11)
   05217 Basal cell carcinoma
    100594864 (WNT11)
   05224 Breast cancer
    100594864 (WNT11)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100594864 (WNT11)
   05022 Pathways of neurodegeneration - multiple diseases
    100594864 (WNT11)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100594864 (WNT11)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100594864 (WNT11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:nle00536]
    100594864 (WNT11)
Glycosaminoglycan binding proteins [BR:nle00536]
 Heparan sulfate / Heparin
  Morphogens
   100594864 (WNT11)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100594864
NCBI-ProteinID: XP_003254741
Ensembl: ENSNLEG00000016841
UniProt: G1S4M0
LinkDB
Position
15
AA seq 354 aa
MRARPQVCEALLFALALQTGVCYGIKWLALSKTPAALALNQTQHCKQLEGLVSAQVQLCR
SNLELMHTVVHAAREVMKACRRAFADMRWNCSSIELAPNYLLDLERGTRESAFVYALSAA
AISHAIARACTSGDLPGCSCGPVPGEPPGPGNRWGGCADNLSYGLLMGAKFSDAPMKVKK
TGSQANKLMRLHNSEVGRQALRASLEMKCKCHGVSGSCSIRTCWKGLQELQDVAADLKTR
YLSATKVVHRPMGTRKHLVPKDLDIRPVKDSELVYLQSSPDFCMKNEKVGSHGTQDRQCN
KTSNGSDSCDLMCCGRGYNPYTDRVVERCHCKYHWCCYVTCRRCERTVERYVCK
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgagggcgcggccgcaggtctgcgaggcgctgctcttcgccctggcgctccagaccggc
gtgtgctatggcatcaagtggctggcgctgtccaagacaccagcggccctggcactgaac
cagacgcaacactgcaagcagctggagggcctggtgtctgcacaggtgcagctgtgccgc
agcaacctggagctcatgcacacggtggtgcacgccgcccgcgaggtcatgaaggcctgt
cgccgggcctttgccgacatgcgctggaactgctcctccattgagctcgcccccaactat
ttgcttgacctggagagagggacccgggagtcggccttcgtgtatgcgctgtcggccgcc
gccatcagccacgccatcgcccgggcctgcacctccggcgacctgcccggttgctcctgc
ggccccgtcccaggtgagccacccgggcccgggaaccgctggggaggatgtgcggacaac
ctcagctacgggctcctcatgggggccaagttttctgatgctcctatgaaggtgaaaaaa
acaggatcccaagccaataaactgatgcgtctacacaacagtgaagtggggagacaggct
ctgcgcgcctctctggaaatgaagtgtaagtgccatggagtgtctggctcctgctccatc
cgcacctgctggaaggggctgcaggagctgcaggatgtggctgctgacctcaagacccga
tacctgtcggccaccaaggtagtgcaccgacccatgggcacccgcaagcacctggtgccc
aaggacctggatatccggcctgtgaaggactcggaactcgtctatctgcagagctcacct
gacttctgcatgaagaatgagaaggtgggctcccacgggacacaagacaggcagtgcaac
aagacatccaacggaagcgacagctgcgaccttatgtgctgcgggcgtggctacaacccc
tacacagaccgcgtggtcgagcggtgccactgtaagtaccactggtgctgctacgtcacc
tgccgcaggtgtgagcgtaccgtggagcgctatgtctgcaagtga

KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100596686
Entry
100596686         CDS       T03265                                 

Gene name
WNT5B
Definition
(RefSeq) protein Wnt-5b
  KO
K00444  wingless-type MMTV integration site family, member 5
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04150  mTOR signaling pathway
nle04310  Wnt signaling pathway
nle04360  Axon guidance
nle04390  Hippo signaling pathway
nle04550  Signaling pathways regulating pluripotency of stem cells
nle04916  Melanogenesis
nle04934  Cushing syndrome
nle05010  Alzheimer disease
nle05022  Pathways of neurodegeneration - multiple diseases
nle05165  Human papillomavirus infection
nle05200  Pathways in cancer
nle05205  Proteoglycans in cancer
nle05217  Basal cell carcinoma
nle05224  Breast cancer
nle05225  Hepatocellular carcinoma
nle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100596686 (WNT5B)
   04390 Hippo signaling pathway
    100596686 (WNT5B)
   04150 mTOR signaling pathway
    100596686 (WNT5B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100596686 (WNT5B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100596686 (WNT5B)
  09158 Development and regeneration
   04360 Axon guidance
    100596686 (WNT5B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100596686 (WNT5B)
   05205 Proteoglycans in cancer
    100596686 (WNT5B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100596686 (WNT5B)
   05226 Gastric cancer
    100596686 (WNT5B)
   05217 Basal cell carcinoma
    100596686 (WNT5B)
   05224 Breast cancer
    100596686 (WNT5B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100596686 (WNT5B)
   05022 Pathways of neurodegeneration - multiple diseases
    100596686 (WNT5B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100596686 (WNT5B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100596686 (WNT5B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:nle00536]
    100596686 (WNT5B)
Glycosaminoglycan binding proteins [BR:nle00536]
 Heparan sulfate / Heparin
  Morphogens
   100596686 (WNT5B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100596686
NCBI-ProteinID: XP_003273729
Ensembl: ENSNLEG00000002648
UniProt: G1QQI2
LinkDB
Position
23
AA seq 359 aa
MPSLLLLFTAALLSSWAQLLTDANSWWSLALNPVQRPEMFIIGAQPVCSQLPGLSPGQRK
LCQLYQEHMAYIGEGAKTGIKECQHQFRQRRWNCSTVDNASVFGRVMQIGSRETAFTYAV
SAAGVVNAISRACREGELSTCGCSRTARPKHLPRDWLWGGCGDNVEYGYRFAKEFVDARE
REKNFARGSEEQGRVLMNLQNNEAGRRAVYKMADVACKCHGVSGSCSLKTCWLQLAEFRK
VGDRLKEKYDSAAAMRVTRKGRLELVNSRFTQPTPEDLVYVDPSPDYCLRNESTGSLGTQ
GRLCNKTSEGMDGCELMCCGRGYNQFKSVQVERCHCKFHWCCFVKCKKCTEIVDQYICK
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgcccagcctgctgctgctgttcacggctgctctgctgtccagctgggctcagcttctg
acagacgccaactcctggtggtcattggctttgaacccggtgcagagacccgagatgttt
atcatcggtgcccagcccgtgtgcagtcagcttccggggctctcccctggccagaggaag
ctgtgccaattgtaccaggagcacatggcctacataggggagggagcgaagactggcatc
aaggaatgccagcaccagttccggcagcggcggtggaactgcagcactgtggacaacgcg
tctgtctttgggagagtcatgcagataggtagccgagagaccgccttcacctacgcggtg
agcgccgcaggcgtggtgaacgccatcagccgggcctgccgcgagggcgagctctccacc
tgcggctgcagccggacagcgcggcccaagcacctgccccgggactggctgtggggtggc
tgtggggacaatgtggagtacggctaccgcttcgccaaggagtttgtggatgcccgggag
cgagagaagaactttgccagagggtcggaggagcagggccgggtgctcatgaacctgcaa
aacaacgaggccggtcgcagggctgtgtataagatggcagacgtagcctgcaaatgccac
ggcgtctcagggtcctgcagcctcaagacctgctggctgcagctggccgagttccgcaag
gtgggggaccggctgaaggagaagtacgacagtgcggccgccatgcgcgtcacccgcaag
ggccggctggagctggtcaacagccgcttcacccagcccaccccggaggacctggtctac
gtggaccccagccccgactactgcctgcgcaacgagagcacgggctccctgggcacgcag
ggccgcctctgcaacaagacctcagagggcatggatggctgtgagctcatgtgctgcggg
cgcggctacaaccagttcaagagcgtgcaggtggagcgctgccactgcaagttccactgg
tgctgcttcgtcaagtgcaagaagtgcacggagatcgtggaccagtacatctgtaaatag

KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100599381
Entry
100599381         CDS       T03265                                 

Gene name
WNT3
Definition
(RefSeq) proto-oncogene Wnt-3
  KO
K00312  wingless-type MMTV integration site family, member 3
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04150  mTOR signaling pathway
nle04310  Wnt signaling pathway
nle04390  Hippo signaling pathway
nle04550  Signaling pathways regulating pluripotency of stem cells
nle04916  Melanogenesis
nle04934  Cushing syndrome
nle05010  Alzheimer disease
nle05022  Pathways of neurodegeneration - multiple diseases
nle05165  Human papillomavirus infection
nle05200  Pathways in cancer
nle05205  Proteoglycans in cancer
nle05206  MicroRNAs in cancer
nle05217  Basal cell carcinoma
nle05224  Breast cancer
nle05225  Hepatocellular carcinoma
nle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100599381 (WNT3)
   04390 Hippo signaling pathway
    100599381 (WNT3)
   04150 mTOR signaling pathway
    100599381 (WNT3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100599381 (WNT3)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100599381 (WNT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100599381 (WNT3)
   05206 MicroRNAs in cancer
    100599381 (WNT3)
   05205 Proteoglycans in cancer
    100599381 (WNT3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100599381 (WNT3)
   05226 Gastric cancer
    100599381 (WNT3)
   05217 Basal cell carcinoma
    100599381 (WNT3)
   05224 Breast cancer
    100599381 (WNT3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100599381 (WNT3)
   05022 Pathways of neurodegeneration - multiple diseases
    100599381 (WNT3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100599381 (WNT3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100599381 (WNT3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:nle00536]
    100599381 (WNT3)
Glycosaminoglycan binding proteins [BR:nle00536]
 Heparan sulfate / Heparin
  Morphogens
   100599381 (WNT3)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100599381
NCBI-ProteinID: XP_003270760
Ensembl: ENSNLEG00000004909
UniProt: G1QYC8
LinkDB
Position
19
AA seq 355 aa
MEPHLLGLLLGLLLGGTRVLAGYPIWWSLALGQQYTSLGSQPLLCGSIPGLVPKQLRFCR
NYIEIMPSVAEGVKLGIQECQHQFRGRRWNCTTIDDSLAIFGPVLDKATRESAFVHAIAS
AGVAFAVTRSCAEGTSTICGCDSHHKGPPGEGWKWGGCSEDADFGVLVSREFADARENRP
DARSAMNKHNNEAGRTTILDHMHLKCKCHGLSGSCEVKTCWWAQPDFRAIGDFLKDKYDS
ASEMVVEKHRESRGWVETLRAKYSLFKPPTERDLVYYENSPNFCEPNPETGSFGTRDRTC
NVTSHGIDGCDLLCCGRGHNTRTEKRKEKCHCIFHWCCYVSCQECIRIYDVHTCK
NT seq 1068 nt   +upstreamnt  +downstreamnt
atggagccccacctgctcgggctgctcctcggcctcctgctcggtggcaccagggtcctc
gctggctacccaatttggtggtccctggccctgggccagcagtacacatctctgggctca
cagcccctgctctgcggctccatcccaggcctggtccccaagcaactgcgcttctgccgc
aattacatcgagatcatgcccagcgtggccgagggcgtgaagctgggcatccaggagtgc
cagcaccagttccggggccgccgctggaactgcaccaccatagatgacagcctggccatc
tttgggcccgtcctcgacaaagccacccgcgagtcggccttcgtgcacgccatcgcctcg
gccggcgtggccttcgccgtcacccgctcctgcgccgagggcacctccaccatttgcggc
tgtgactcgcatcataaggggccgcctggcgaaggctggaagtggggcggctgcagcgag
gacgctgacttcggggtgttagtgtccagggagttcgcggatgcgcgcgagaacaggccg
gacgcgcgctcggccatgaacaagcacaacaacgaggcgggccgcacgactatcctggac
cacatgcacctcaaatgcaagtgccacgggctgtcgggcagctgtgaggtgaagacctgc
tggtgggcgcagcctgacttccgtgccatcggtgacttcctcaaggacaagtatgacagc
gcctcggagatggtagtagagaagcaccgtgagtcccgaggctgggtggagaccctccgg
gccaagtactcgctcttcaagccacccaccgagagggacctggtctactacgagaactcc
cccaacttttgtgagcccaacccagagacgggttcgtttggcacaagggaccggacttgc
aatgtcacctcccacggcattgatggctgcgatctgctctgctgtggccggggccacaac
acgaggacggagaagcggaaggaaaaatgccactgcatcttccactggtgctgctacgtc
agctgccaggagtgtattcgcatctacgacgtgcacacctgcaagtag

KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100600353
Entry
100600353         CDS       T03265                                 

Gene name
WNT2
Definition
(RefSeq) protein Wnt-2
  KO
K00182  wingless-type MMTV integration site family, member 2
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04150  mTOR signaling pathway
nle04310  Wnt signaling pathway
nle04390  Hippo signaling pathway
nle04550  Signaling pathways regulating pluripotency of stem cells
nle04916  Melanogenesis
nle04934  Cushing syndrome
nle05010  Alzheimer disease
nle05022  Pathways of neurodegeneration - multiple diseases
nle05165  Human papillomavirus infection
nle05200  Pathways in cancer
nle05205  Proteoglycans in cancer
nle05217  Basal cell carcinoma
nle05224  Breast cancer
nle05225  Hepatocellular carcinoma
nle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100600353 (WNT2)
   04390 Hippo signaling pathway
    100600353 (WNT2)
   04150 mTOR signaling pathway
    100600353 (WNT2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100600353 (WNT2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100600353 (WNT2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100600353 (WNT2)
   05205 Proteoglycans in cancer
    100600353 (WNT2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100600353 (WNT2)
   05226 Gastric cancer
    100600353 (WNT2)
   05217 Basal cell carcinoma
    100600353 (WNT2)
   05224 Breast cancer
    100600353 (WNT2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100600353 (WNT2)
   05022 Pathways of neurodegeneration - multiple diseases
    100600353 (WNT2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100600353 (WNT2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100600353 (WNT2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:nle00536]
    100600353 (WNT2)
Glycosaminoglycan binding proteins [BR:nle00536]
 Heparan sulfate / Heparin
  Morphogens
   100600353 (WNT2)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100600353
NCBI-ProteinID: XP_003261284
Ensembl: ENSNLEG00000011635
UniProt: Q07DX7
LinkDB
Position
13
AA seq 360 aa
MNAPLGGIWLWLPLLLTWLTPEVNSSWWYMRATGGSSRVMCDNVPGLVSSQRQLCHRHPD
VMRAISQGVAEWTAECQYQFRQHRWNCNTLDRDHSLFGRVLLRSSRESAFVYAISSAGVV
FAITRACSQGEVKSCSCDPKKMGSAKDSKGIFDWGGCSDNIDYGIKFARAFVDAKERKGK
DARALMNLHNNRAGRKAVKRFLKQECKCHGVSGSCTLRTCWLAMADFRKTGDYLWRKYNG
AIQVVMNQDGTGFTVANERFKKPTKNDLVYFENSPDYCIRDREAGSLGTAGRVCNLTSRG
MDSCEVMCCGRGYDTSHVTRMTKCGCKFHWCCAVRCQDCLEALDVHTCKAPKNADWTTPT
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgaacgcccctctcggtggaatctggctctggctccctctgctcttgacctggctcacc
cccgaggtcaactcttcatggtggtacatgagagctacaggtggctcctccagggtgatg
tgcgataatgtgccaggcctggtgagcagccagcggcaactgtgtcaccgacatccagat
gtgatgcgtgccattagccagggcgtggccgagtggacagcggaatgccagtaccagttc
cgccagcaccgctggaattgcaacaccctggacagggatcacagcctctttggcagggtc
ctactccgaagtagtcgggaatctgcctttgtttatgccatctcctcagctggagttgta
tttgccatcaccagggcctgtagccaaggagaagtaaaatcctgctcctgtgatccaaag
aagatgggaagcgccaaggacagcaagggcatttttgattggggtggctgcagtgataac
attgactatgggatcaagttcgcccgcgcatttgtggatgcaaaggaaaggaaaggaaag
gatgccagagccctgatgaatcttcacaacaacagagctggcaggaaggctgtaaagcgg
ttcttgaaacaagagtgcaagtgccacggggtgagcggctcatgtactctcaggacatgc
tggctggccatggccgacttcaggaaaacgggcgattatctctggagaaagtacaatggg
gccatccaggtggtcatgaaccaggatggcacaggtttcactgtggctaacgagaggttt
aagaagccaacaaaaaatgacctcgtgtattttgagaattctccagactactgtatcagg
gaccgagaggcaggctccctgggtacagcaggccgtgtgtgcaacctgacttcccggggc
atggacagctgcgaagtcatgtgctgtgggagaggctacgacacctcccatgtcacccgg
atgacgaagtgtgggtgtaagttccactggtgctgcgctgtgcgctgtcaggactgcctg
gaagctctggacgtgcacacatgcaaggcccccaagaacgctgactggacaacccctaca
tga

KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100602014
Entry
100602014         CDS       T03265                                 

Gene name
WNT5A
Definition
(RefSeq) protein Wnt-5a
  KO
K00444  wingless-type MMTV integration site family, member 5
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04150  mTOR signaling pathway
nle04310  Wnt signaling pathway
nle04360  Axon guidance
nle04390  Hippo signaling pathway
nle04550  Signaling pathways regulating pluripotency of stem cells
nle04916  Melanogenesis
nle04934  Cushing syndrome
nle05010  Alzheimer disease
nle05022  Pathways of neurodegeneration - multiple diseases
nle05165  Human papillomavirus infection
nle05200  Pathways in cancer
nle05205  Proteoglycans in cancer
nle05217  Basal cell carcinoma
nle05224  Breast cancer
nle05225  Hepatocellular carcinoma
nle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100602014 (WNT5A)
   04390 Hippo signaling pathway
    100602014 (WNT5A)
   04150 mTOR signaling pathway
    100602014 (WNT5A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100602014 (WNT5A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100602014 (WNT5A)
  09158 Development and regeneration
   04360 Axon guidance
    100602014 (WNT5A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100602014 (WNT5A)
   05205 Proteoglycans in cancer
    100602014 (WNT5A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100602014 (WNT5A)
   05226 Gastric cancer
    100602014 (WNT5A)
   05217 Basal cell carcinoma
    100602014 (WNT5A)
   05224 Breast cancer
    100602014 (WNT5A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100602014 (WNT5A)
   05022 Pathways of neurodegeneration - multiple diseases
    100602014 (WNT5A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100602014 (WNT5A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100602014 (WNT5A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:nle00536]
    100602014 (WNT5A)
Glycosaminoglycan binding proteins [BR:nle00536]
 Heparan sulfate / Heparin
  Morphogens
   100602014 (WNT5A)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100602014
NCBI-ProteinID: XP_030667447
Ensembl: ENSNLEG00000007237
LinkDB
Position
4
AA seq 380 aa
MKKSIGILSPGVALGMAGSAMSSKFFLMALAIFFSFAQVVIEANSWWSLGMNNPVQMSEV
YIIGAQPLCSQLAGLSQGQKKLCHLYQDHMQYIGEGAKTGIKECQYQFRHRRWNCSTVDN
TSVFGRVMQIGSRETAFTYAVSAAGVVNAMSRACREGELSTCGCSRAARPKDLPRDWLWG
GCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRTVYNLADVACKC
HGVSGSCSLKTCWLQLADFRKVGDALKEKYDSAAAMRLNSRGKLVQVNSRFNSPTTQDLV
YIDPSPDYCVRNESTGSLGTQGRLCNKTSEGMDGCELMCCGRGYDQFKTVQTERCHCKFH
WCCYVKCKKCTEIVDQFVCK
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgaagaagtccattggaatattaagcccaggagttgctttggggatggctggaagtgca
atgtcttccaagttcttcctaatggctttggccatatttttctccttcgcccaggttgta
attgaagccaattcttggtggtcgctaggtatgaataaccctgttcagatgtcagaagta
tatattataggagcacagcctctctgcagccaactggcaggactttctcaaggacagaag
aaactgtgccacttgtatcaggaccacatgcagtacattggagaaggcgcgaagacaggc
atcaaagaatgccagtatcaattccgacatcgaaggtggaactgcagcactgtggataac
acctctgtttttggcagggtgatgcagataggcagccgcgagacggccttcacatacgcg
gtgagcgcagcaggggtggtgaacgccatgagccgggcgtgccgcgagggcgagctgtcc
acctgcggctgcagccgcgccgcacgccccaaggacctgccgcgggactggctctggggc
ggctgcggcgacaacatcgactatggctaccgctttgccaaggagtttgtggacgcccgc
gagcgggagcgcatccacgccaaaggctcctacgagagtgctcgcatcctcatgaacctg
cacaacaatgaggcgggccgcaggacggtgtacaacctggctgatgtggcctgcaagtgc
catggggtgtccggctcatgtagcctgaagacatgctggctgcagctggcggacttccgc
aaggtgggtgatgccctgaaggagaagtacgacagcgcggcggccatgcggctcaacagc
cggggcaagttggtgcaggtcaacagccgcttcaactcgcccaccacacaagacctggtc
tacatcgaccctagccctgactactgcgtgcgcaatgagagcaccggctcgctgggcacg
cagggccgcctgtgcaacaagacgtcggagggcatggatggctgcgagctcatgtgctgc
ggccgcggctacgaccagttcaagaccgtgcagacggagcgctgccactgcaagttccac
tggtgctgctacgtcaagtgcaagaagtgcacggagatcgtggaccagtttgtgtgcaag
tag

KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100602760
Entry
100602760         CDS       T03265                                 

Gene name
WNT9B
Definition
(RefSeq) protein Wnt-9b isoform X1
  KO
K01064  wingless-type MMTV integration site family, member 9
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04150  mTOR signaling pathway
nle04310  Wnt signaling pathway
nle04390  Hippo signaling pathway
nle04550  Signaling pathways regulating pluripotency of stem cells
nle04916  Melanogenesis
nle04934  Cushing syndrome
nle05010  Alzheimer disease
nle05022  Pathways of neurodegeneration - multiple diseases
nle05165  Human papillomavirus infection
nle05200  Pathways in cancer
nle05205  Proteoglycans in cancer
nle05217  Basal cell carcinoma
nle05224  Breast cancer
nle05225  Hepatocellular carcinoma
nle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100602760 (WNT9B)
   04390 Hippo signaling pathway
    100602760 (WNT9B)
   04150 mTOR signaling pathway
    100602760 (WNT9B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100602760 (WNT9B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100602760 (WNT9B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100602760 (WNT9B)
   05205 Proteoglycans in cancer
    100602760 (WNT9B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100602760 (WNT9B)
   05226 Gastric cancer
    100602760 (WNT9B)
   05217 Basal cell carcinoma
    100602760 (WNT9B)
   05224 Breast cancer
    100602760 (WNT9B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100602760 (WNT9B)
   05022 Pathways of neurodegeneration - multiple diseases
    100602760 (WNT9B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100602760 (WNT9B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100602760 (WNT9B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:nle00536]
    100602760 (WNT9B)
Glycosaminoglycan binding proteins [BR:nle00536]
 Heparan sulfate / Heparin
  Morphogens
   100602760 (WNT9B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100602760
NCBI-ProteinID: XP_030655766
LinkDB
Position
19
AA seq 358 aa
MRPPPALALAGLCLLALPTAAAASYFGLTGREVLTPFPGLGTAAAPAEGGAHLKQCDLLK
LSRRQKQLCRREPGLAETLRDAAHLGLLECQFQFRHERWNCSLEGRTGLLKRGFKETAFL
YAVSSAALTHTLARACSAGRMERCTCDDSPGLESRQAWQWGVCGDNLKYSTKFLSNFLGS
KRGNKDLRARADAHNTHVGIKAVKSGLRTTCKCHGVSGSCAVRTCWKQLSPFRETGQVLK
LRYDSAVKVSSATNEALGRLELWAPARQGSLTKGLAPRSGDLVYMEDSPSFCRPSKYSPG
TAGRVCSREASCSSLCCGRGYDTQSRLVAFSCHCQVQWCCYVECQQCVQEELVYTCKH
NT seq 1077 nt   +upstreamnt  +downstreamnt
atgcgccccccgcccgcgctggccctggccgggctctgcctgctggcgctgcccaccgcc
gccgccgcctcctacttcggcctgaccgggcgggaagtcctgacgcccttcccaggattg
ggcactgcggcggccccggcagagggcggggcccacctgaagcagtgcgacctgctgaag
ctctcccggcggcagaagcagctctgccggagggagcccggcctggctgagaccctgagg
gacgctgcgcacctcggcctgcttgagtgccagtttcagttccggcatgagcgctggaac
tgtagcctggagggcaggacaggcctgctcaagagaggcttcaaagagacagctttcctg
tacgcagtgtcctctgccgccctcacccacaccctggcccgggcctgcagtgctgggcgc
atggagcgctgcacctgtgatgactctccagggctggagagccggcaggcctggcagtgg
ggtgtgtgcggtgacaacctcaagtacagcaccaagtttctgagcaacttcctggggtcc
aagagaggcaacaaggacctgcgggcacgggcagacgcccacaacacccacgtgggcatc
aaggctgtgaagagtggcctcaggaccacgtgtaagtgccatggcgtatcaggctcctgt
gccgtgcgcacctgctggaagcagctctccccattccgtgagacgggccaggtgctgaaa
ctgcgctatgactcggctgtcaaggtgtccagcgccaccaatgaggccttgggccgccta
gagctgtgggcccctgccaggcagggcagcctcaccaaaggcctggccccgaggtctggg
gacctggtctacatggaggactcacccagcttctgccggcccagcaagtactcgcctggc
acagcgggtagggtgtgctcccgggaagccagctgcagcagcctgtgctgcgggcggggc
tatgacacccagagccgcctggtggccttctcctgccactgccaggtgcagtggtgctgc
tacgtggagtgccagcaatgtgtgcaggaggagcttgtgtacacctgcaagcactag

KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100603238
Entry
100603238         CDS       T03265                                 

Gene name
WNT8B
Definition
(RefSeq) protein Wnt-8b
  KO
K00714  wingless-type MMTV integration site family, member 8
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04150  mTOR signaling pathway
nle04310  Wnt signaling pathway
nle04390  Hippo signaling pathway
nle04550  Signaling pathways regulating pluripotency of stem cells
nle04916  Melanogenesis
nle04934  Cushing syndrome
nle05010  Alzheimer disease
nle05022  Pathways of neurodegeneration - multiple diseases
nle05165  Human papillomavirus infection
nle05200  Pathways in cancer
nle05205  Proteoglycans in cancer
nle05217  Basal cell carcinoma
nle05224  Breast cancer
nle05225  Hepatocellular carcinoma
nle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100603238 (WNT8B)
   04390 Hippo signaling pathway
    100603238 (WNT8B)
   04150 mTOR signaling pathway
    100603238 (WNT8B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100603238 (WNT8B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100603238 (WNT8B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100603238 (WNT8B)
   05205 Proteoglycans in cancer
    100603238 (WNT8B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100603238 (WNT8B)
   05226 Gastric cancer
    100603238 (WNT8B)
   05217 Basal cell carcinoma
    100603238 (WNT8B)
   05224 Breast cancer
    100603238 (WNT8B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100603238 (WNT8B)
   05022 Pathways of neurodegeneration - multiple diseases
    100603238 (WNT8B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100603238 (WNT8B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100603238 (WNT8B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:nle00536]
    100603238 (WNT8B)
Glycosaminoglycan binding proteins [BR:nle00536]
 Heparan sulfate / Heparin
  Morphogens
   100603238 (WNT8B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100603238
NCBI-ProteinID: XP_003255389
Ensembl: ENSNLEG00000014764
UniProt: G1RXH2
LinkDB
Position
3
AA seq 351 aa
MFLSKPSVYISLFTCVLQLSHSWSVNNFLMTGPKAYLIYSSSVAAGAQSGIEECKYQFAW
DRWNCPERALQLSSHGGLRSANRETAFVHAISSAGVMYTLTRNCSLGDFDNCGCDDSRNG
QLGGQGWLWGGCSDNVGFGEAISKQFVDALETGQDARAAMNLHNNEAGRKAVKGTMKRTC
KCHGVSGSCTTQTCWLQLPEFREVGAHLKEKYHAALKVDLLQGAGNSAAGRGAIADTFRS
ISTRELVHLEDSPDYCLENKTLGLLGTEGRECLRRGRALGRWERRSCRRLCGDCGLAVEE
RRAETVSSCNCKFHWCCAVRCEQCRRRVTKYFCSRAERPRGGAAHKPGRKP
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgtttctttcaaagccttctgtgtacatctctcttttcacctgtgtcctccaactcagc
cacagctggtcagtaaacaatttcctgatgactggtccaaaggcttacctgatttactcc
agcagtgtggcagctggtgcccagagtggtattgaagaatgcaagtatcagtttgcctgg
gaccgctggaactgccctgagagagccctgcagctgtccagccatggtgggcttcgcagt
gccaatcgggagacagcatttgtgcatgccatcagttctgctggagtcatgtacaccctg
actagaaactgcagccttggagattttgataactgtggctgtgatgactcccgcaatggg
caactggggggccaaggctggctgtggggaggctgcagtgacaatgtgggcttcggagag
gcgatttccaagcagtttgtcgatgccctggaaacaggacaggatgcacgggcagccatg
aacctgcacaacaacgaggctggccgcaaggcggtgaagggcaccatgaaacgcacgtgc
aagtgccacggcgtgtctggcagctgcaccacgcagacctgttggctgcagctgcccgag
ttccgcgaggtgggcgcgcacctgaaggagaagtaccacgcagcactcaaggtggacctg
ctgcagggtgctggcaacagcgcggccggccgcggcgccatcgccgacacctttcgctcc
atctctacccgggagctggtgcacctggaggactccccggactactgcctggagaacaaa
acgctagggctgctgggcaccgaaggccgagagtgcctgaggcgcgggcgggccctgggt
cgctgggaacgccgcagctgccgccggctctgcggggactgcgggctggcggtggaggag
cgccgggccgagaccgtgtccagctgcaactgcaagttccactggtgctgcgcagtccgc
tgcgagcagtgccgccggagggtcaccaagtacttctgtagccgcgcagagcggccgcgg
gggggcgctgcgcacaaacccgggagaaaaccctaa

KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100604353
Entry
100604353         CDS       T03265                                 

Gene name
WNT4
Definition
(RefSeq) protein Wnt-4 isoform X1
  KO
K00408  wingless-type MMTV integration site family, member 4
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04150  mTOR signaling pathway
nle04310  Wnt signaling pathway
nle04360  Axon guidance
nle04390  Hippo signaling pathway
nle04550  Signaling pathways regulating pluripotency of stem cells
nle04916  Melanogenesis
nle04919  Thyroid hormone signaling pathway
nle04934  Cushing syndrome
nle05010  Alzheimer disease
nle05022  Pathways of neurodegeneration - multiple diseases
nle05165  Human papillomavirus infection
nle05200  Pathways in cancer
nle05205  Proteoglycans in cancer
nle05217  Basal cell carcinoma
nle05224  Breast cancer
nle05225  Hepatocellular carcinoma
nle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100604353 (WNT4)
   04390 Hippo signaling pathway
    100604353 (WNT4)
   04150 mTOR signaling pathway
    100604353 (WNT4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100604353 (WNT4)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100604353 (WNT4)
   04916 Melanogenesis
    100604353 (WNT4)
  09158 Development and regeneration
   04360 Axon guidance
    100604353 (WNT4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100604353 (WNT4)
   05205 Proteoglycans in cancer
    100604353 (WNT4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100604353 (WNT4)
   05226 Gastric cancer
    100604353 (WNT4)
   05217 Basal cell carcinoma
    100604353 (WNT4)
   05224 Breast cancer
    100604353 (WNT4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100604353 (WNT4)
   05022 Pathways of neurodegeneration - multiple diseases
    100604353 (WNT4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100604353 (WNT4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100604353 (WNT4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:nle00536]
    100604353 (WNT4)
Glycosaminoglycan binding proteins [BR:nle00536]
 Heparan sulfate / Heparin
  Morphogens
   100604353 (WNT4)
SSDB
Motif
Pfam: wnt MEF2_binding
Other DBs
NCBI-GeneID: 100604353
NCBI-ProteinID: XP_030661127
Ensembl: ENSNLEG00000008238
LinkDB
Position
24
AA seq 351 aa
MSPRSCLRSLRLLVFAVFSAAASNWLYLAKLSSVGSISEEETCEKLKGLIQRQVQMCKRN
LEVMDSVRRGAQLAIEECQYQFRNRRWNCSTLDSLPVFGKVVTQGTREAAFVYAISSAGV
AFAVTRACSSGELEKCGCDRTVHGVSPQGFQWSGCSDNIAYGVAFSQSFVDVRERSKGAS
SSRALMNLHNNEAGRKAILTHMRVECKCHGVSGSCEVKTCWRAVPPFRQVGHALKEKFDG
ATEVEPRRVGSSRALVPRNAQFKPHTDEDLVYLEPSPDFCEQDMRSGVLGTRGRTCNKTS
KAIDGCELLCCGRGFHTAQVELAERCSCKFHWCCFVKCRQCQRLVELHTCR
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgagtccccgctcgtgcctgcgttcgctgcgcctcctcgtcttcgccgtcttctcagcc
gccgcgagcaactggctgtacctggccaagctgtcgtcagtggggagcatctcagaggag
gagacatgcgagaaactcaagggcctaatccagaggcaggtgcagatgtgcaagcggaac
ctggaagtcatggactcggtgcgccgcggtgcccaactggccatcgaggagtgccagtac
cagttccggaaccggcgctggaactgctccacactcgactccctgcccgtcttcggcaag
gtggtgacgcaagggactcgggaggcggccttcgtgtacgccatctcttcggcaggtgtg
gcctttgcagtgacacgggcgtgcagcagtggggagctggagaagtgcggctgtgacagg
acggtgcacggagtcagcccacagggcttccagtggtcaggatgctctgacaacatcgcc
tacggtgtggccttctcacagtcgtttgtggatgtgcgggagagaagcaagggggcctcg
tccagcagagccctcatgaacctccacaacaatgaggccggcaggaaggccatcctgaca
cacatgcgggtggaatgcaagtgccacggggtgtcaggctcctgtgaggtaaagacgtgc
tggcgagccgtgccgcccttccgccaggtgggtcacgcactgaaggagaagtttgatggt
gccactgaggtggagccacgccgcgtgggctcctccagggcactggtgccacgcaacgca
cagttcaagccgcacacagatgaggacctggtgtacttggagcctagccccgacttctgc
gagcaggacatgcgcagcggcgtgctgggcacgaggggccgcacatgcaacaagacgtcc
aaggccatcgacggctgtgagctgctgtgctgtggccgcggcttccacacggcgcaggtg
gagctggctgaacgctgcagctgcaaattccactggtgctgcttcgtcaagtgccggcag
tgccagcggctcgtggagttgcacacgtgccgatga

KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100605294
Entry
100605294         CDS       T03265                                 

Gene name
WNT16
Definition
(RefSeq) protein Wnt-16 isoform X1
  KO
K01558  wingless-type MMTV integration site family, member 16
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04150  mTOR signaling pathway
nle04310  Wnt signaling pathway
nle04390  Hippo signaling pathway
nle04550  Signaling pathways regulating pluripotency of stem cells
nle04916  Melanogenesis
nle04934  Cushing syndrome
nle05010  Alzheimer disease
nle05022  Pathways of neurodegeneration - multiple diseases
nle05165  Human papillomavirus infection
nle05200  Pathways in cancer
nle05202  Transcriptional misregulation in cancer
nle05205  Proteoglycans in cancer
nle05217  Basal cell carcinoma
nle05224  Breast cancer
nle05225  Hepatocellular carcinoma
nle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100605294 (WNT16)
   04390 Hippo signaling pathway
    100605294 (WNT16)
   04150 mTOR signaling pathway
    100605294 (WNT16)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100605294 (WNT16)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100605294 (WNT16)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100605294 (WNT16)
   05202 Transcriptional misregulation in cancer
    100605294 (WNT16)
   05205 Proteoglycans in cancer
    100605294 (WNT16)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100605294 (WNT16)
   05226 Gastric cancer
    100605294 (WNT16)
   05217 Basal cell carcinoma
    100605294 (WNT16)
   05224 Breast cancer
    100605294 (WNT16)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100605294 (WNT16)
   05022 Pathways of neurodegeneration - multiple diseases
    100605294 (WNT16)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100605294 (WNT16)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100605294 (WNT16)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:nle00536]
    100605294 (WNT16)
Glycosaminoglycan binding proteins [BR:nle00536]
 Heparan sulfate / Heparin
  Morphogens
   100605294 (WNT16)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100605294
NCBI-ProteinID: XP_003261299
Ensembl: ENSNLEG00000011905
UniProt: G1RMK0
LinkDB
Position
13
AA seq 365 aa
MDRAALLGLARLCALWAALLVLFPYGAQGNWMWLGIASFGVPEKLGCANLPLNSRQKELC
KRKPYLLPSIREGARLGIQECRSQFRHERWNCMITAAATTAPMGASPLFGYELSSGTKET
AFIYAVMAAGLVHSVTRSCSAGNMTECSCDTTLQNGGSASEGWHWGGCSDDVQYGMWFSR
KFLDFPIGNTTGKENKVLLAMNLHNNEAGRQAVAKLMSVDCRCHGVSGSCAVKTCWKTMS
SFEKIGHLLKDKYENSIQISEKIKRKMRRREKDQRKIPIHKDDLLYVNKSPNYCVEDKKL
GIPGTQGRECNRTSEGADGCNLLCCGRGYNTHVVRHVERCECKFIWCCYVRCRRCESMTD
VHTCK
NT seq 1098 nt   +upstreamnt  +downstreamnt
atggacagggcggcgctcctgggactggcccgcctgtgcgcgctgtgggcagccctgctc
gtgctgttcccctacggagcccaaggaaactggatgtggttgggcattgcctccttcggg
gttccagagaagctgggctgcgccaatttgccgctgaacagccgccagaaggagctgtgc
aagagaaaaccgtacctgctgccgagcatccgagagggcgcccggctgggcattcaggag
tgcaggagccagttcagacacgagagatggaactgcatgatcaccgccgccgccaccacg
gccccgatgggcgccagccccctctttggctacgagctgagcagcggcaccaaagagaca
gcatttatttacgctgtgatggctgcaggcctggtgcattctgtgaccaggtcatgcagt
gcaggcaacatgacagagtgttcctgtgacaccaccttgcagaacggcggctcagcaagt
gaaggctggcactgggggggctgttccgatgatgtccagtatggcatgtggttcagcaga
aagttcctagatttccccatcggaaacacaacgggcaaagaaaacaaagtactattagcg
atgaacctacataacaatgaagctggaaggcaggctgtcgccaagttgatgtcagtagac
tgccgctgccacggagtttctggctcctgtgctgtgaaaacatgctggaaaaccatgtct
tcttttgaaaagattggtcatttgttgaaggataaatacgaaaacagtatccagatatca
gaaaaaataaagaggaaaatgcgcaggagagaaaaagatcagaggaaaataccaatccac
aaggatgatctgctttatgttaataagtctcccaactactgtgtagaagataagaaactg
ggaatcccagggacacaaggcagagaatgcaaccgtacatcagagggtgcagatggctgc
aacctcctctgctgtggccgaggttacaacacccacgtggtcaggcacgtggagaggtgt
gagtgtaagttcatctggtgctgctatgtccgttgcaggaggtgtgaaagcatgactgat
gtccatacttgcaagtaa

KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100606502
Entry
100606502         CDS       T03265                                 

Gene name
WNT9A
Definition
(RefSeq) protein Wnt-9a
  KO
K01064  wingless-type MMTV integration site family, member 9
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04150  mTOR signaling pathway
nle04310  Wnt signaling pathway
nle04390  Hippo signaling pathway
nle04550  Signaling pathways regulating pluripotency of stem cells
nle04916  Melanogenesis
nle04934  Cushing syndrome
nle05010  Alzheimer disease
nle05022  Pathways of neurodegeneration - multiple diseases
nle05165  Human papillomavirus infection
nle05200  Pathways in cancer
nle05205  Proteoglycans in cancer
nle05217  Basal cell carcinoma
nle05224  Breast cancer
nle05225  Hepatocellular carcinoma
nle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100606502 (WNT9A)
   04390 Hippo signaling pathway
    100606502 (WNT9A)
   04150 mTOR signaling pathway
    100606502 (WNT9A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100606502 (WNT9A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100606502 (WNT9A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100606502 (WNT9A)
   05205 Proteoglycans in cancer
    100606502 (WNT9A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100606502 (WNT9A)
   05226 Gastric cancer
    100606502 (WNT9A)
   05217 Basal cell carcinoma
    100606502 (WNT9A)
   05224 Breast cancer
    100606502 (WNT9A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100606502 (WNT9A)
   05022 Pathways of neurodegeneration - multiple diseases
    100606502 (WNT9A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100606502 (WNT9A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100606502 (WNT9A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:nle00536]
    100606502 (WNT9A)
Glycosaminoglycan binding proteins [BR:nle00536]
 Heparan sulfate / Heparin
  Morphogens
   100606502 (WNT9A)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100606502
NCBI-ProteinID: XP_030668621
LinkDB
Position
5
AA seq 365 aa
MLDGSPLGRWLAAAFGLTLLLAALRPSAAYFGLTGSEPLTVLPLTLEPEAAAQAHYKACD
RLKLERKQRRMCRRDPGVAETLVEAVSMSALECQFQFRFERWNCTLEGRYRASLLKRGFK
ETAFLYAISSAGLTHALAKACSAGRMERCTCDEAPDLENREAWQWGGCGDNLKYSSKFVK
EFLGRRSSKDLRARVDFHNNLVGVKVIKAGVETTCKCHGVSGSCTVRTCWRQLAPFHEVG
KHLKHKYETALKVGSTTNEAAGEAGAISPPRGRASGVGGSDPLPRTPELVHLDDSPSFCL
AGRFSPGTAGRRCHREKNCESICCGRGHNTQSRVVTRPCQCQVRWCCYVECRQCTQREEV
YTCKG
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgctggatgggtccccgctggggcgctggctggccgcggccttcgggctgacgctgctg
ctcgccgcgctgcgcccttcggccgcctacttcgggctgacaggcagcgagcccctgact
gtccttccgctgaccctggagccagaggcggccgcccaggcgcactacaaggcctgcgac
cggctgaagctggagcggaagcagcggcgcatgtgccgccgggacccgggagtggcagag
acgctggtggaggccgtgagcatgagtgcgctcgagtgccagttccagttccgctttgag
cgctggaactgcacgctggagggccgctaccgggccagcctgctcaagcgaggcttcaag
gagactgccttcctctatgccatctcctcggctggcctgacgcacgcactggccaaggcg
tgcagcgcgggccgcatggagcgctgtacctgcgatgaggcgcccgacctggagaaccgt
gaggcctggcagtgggggggctgcggagacaacctcaagtacagcagcaagtttgtcaag
gaattcctgggcagacggtcaagcaaagatctgcgagcccgtgtggacttccacaacaac
ctcgtgggtgtgaaggtgatcaaggctggggtggagaccacctgcaagtgccacggtgtg
tcaggctcatgcacggtgcggacctgctggcggcagttggcgcctttccatgaggtgggc
aagcatctgaagcacaagtatgagacggcactcaaggtgggcagcaccaccaacgaagct
gccggtgaggcaggcgccatctccccaccacggggccgtgcctcgggggtaggcggcagc
gacccactgccccgtactccagagctggtgcacctggacgactcgcctagcttctgcctg
gccggccgcttctccccgggcaccgctggccgtaggtgccaccgcgagaagaactgtgag
agcatctgctgtggccgtggccataacacacagagccgggtggtgacgaggccctgccag
tgccaggtgcgttggtgctgctatgtggagtgcaggcagtgcacgcagcgtgaggaggtc
tacacctgcaagggctga

KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100606818
Entry
100606818         CDS       T03265                                 

Gene name
WNT6
Definition
(RefSeq) protein Wnt-6
  KO
K00445  wingless-type MMTV integration site family, member 6
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04150  mTOR signaling pathway
nle04310  Wnt signaling pathway
nle04390  Hippo signaling pathway
nle04550  Signaling pathways regulating pluripotency of stem cells
nle04916  Melanogenesis
nle04934  Cushing syndrome
nle05010  Alzheimer disease
nle05022  Pathways of neurodegeneration - multiple diseases
nle05165  Human papillomavirus infection
nle05200  Pathways in cancer
nle05205  Proteoglycans in cancer
nle05217  Basal cell carcinoma
nle05224  Breast cancer
nle05225  Hepatocellular carcinoma
nle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100606818 (WNT6)
   04390 Hippo signaling pathway
    100606818 (WNT6)
   04150 mTOR signaling pathway
    100606818 (WNT6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100606818 (WNT6)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100606818 (WNT6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100606818 (WNT6)
   05205 Proteoglycans in cancer
    100606818 (WNT6)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100606818 (WNT6)
   05226 Gastric cancer
    100606818 (WNT6)
   05217 Basal cell carcinoma
    100606818 (WNT6)
   05224 Breast cancer
    100606818 (WNT6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100606818 (WNT6)
   05022 Pathways of neurodegeneration - multiple diseases
    100606818 (WNT6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100606818 (WNT6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100606818 (WNT6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:nle00536]
    100606818 (WNT6)
Glycosaminoglycan binding proteins [BR:nle00536]
 Heparan sulfate / Heparin
  Morphogens
   100606818 (WNT6)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100606818
NCBI-ProteinID: XP_003272425
Ensembl: ENSNLEG00000008977
UniProt: G1RCK4
LinkDB
Position
22a
AA seq 365 aa
MLPPAPSRLGLLLLLLLCPAHVGGLWWAVGSPLVMDPTSICRKARRLAGRQAELCQAEPE
VVAELARGARLGVRECQFQFRFRRWNCSSHSKAFGRILQQDIRETAFVFAITAAGASHAV
TQACSMGELLQCGCQAPRGRAPPRPSGLPGTPGPPSPAGSPEGSAAWEWGGCGDDVDFGD
EKSRLFMDARHKRGRGDIRALVQLHNNEAGRLAVRSHTRTECKCHGLSGSCALRTCWQKL
PPFREVGARLLERFHGASRVMGTNDGKALLPAVRTLKPPGRADLLYAADSPDFCAPNRRT
GSPGTRGRACNSSAPDLSGCDLLCCGRGHRQESVQLEENCLCRFHWCCVVQCHRCRVRKE
LSLCL
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgctgccgcccgcaccctcccgcctcgggctgctgctgctgctgctcctgtgcccggcg
cacgtcggcggactgtggtgggctgtgggcagccccttggttatggaccctaccagcatc
tgcaggaaggcacggcggctagccgggcggcaggccgagttgtgccaggctgagccggaa
gtggtggcagagctagcccggggcgcccgacttggggtgcgagagtgccagttccagttc
cgcttccgccgctggaactgctccagccacagcaaggcctttggacgcatcctgcaacag
gacattcgggagacggccttcgtgttcgccatcaccgcggcaggcgccagccacgccgtc
acgcaggcctgttctatgggcgagctgctgcagtgcggctgccaggcgccccgcgggcgg
gcgcctccccggccctccggcctgcccggcacccccggaccccctagccccgcgggctct
ccggaaggcagcgccgcctgggagtggggaggctgcggcgacgacgtggacttcggggac
gagaagtcgaggctctttatggacgcgcggcacaagcggggacgcggagacatccgcgcg
ttggtgcaactgcacaacaacgaggcgggccggctggccgtgcggagccacacgcgcacc
gagtgcaaatgccacgggctgtcgggctcatgcgcgctgcgcacctgctggcagaagctg
cctccgtttcgcgaggtgggcgcgcggctgctggagcgcttccacggcgcctcacgcgtc
atgggcaccaacgacggcaaggccctgctgcccgccgtccgcacgctcaagccgccgggc
cgagcggacctcctctacgccgccgattcgcccgacttctgcgcccccaaccgacgcacc
ggctcccctggcacgcgcggtcgcgcctgcaatagcagcgccccggacctcagcggctgc
gacctgctgtgctgcggccgcgggcaccgccaggagagcgtgcagctcgaagagaactgc
ctgtgccgcttccactggtgctgcgtagtacagtgccaccgctgccgtgtgcgcaaggag
ctcagcctctgcctctga

KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100606846
Entry
100606846         CDS       T03265                                 

Gene name
WNT3A
Definition
(RefSeq) protein Wnt-3a isoform X2
  KO
K00312  wingless-type MMTV integration site family, member 3
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04150  mTOR signaling pathway
nle04310  Wnt signaling pathway
nle04390  Hippo signaling pathway
nle04550  Signaling pathways regulating pluripotency of stem cells
nle04916  Melanogenesis
nle04934  Cushing syndrome
nle05010  Alzheimer disease
nle05022  Pathways of neurodegeneration - multiple diseases
nle05165  Human papillomavirus infection
nle05200  Pathways in cancer
nle05205  Proteoglycans in cancer
nle05206  MicroRNAs in cancer
nle05217  Basal cell carcinoma
nle05224  Breast cancer
nle05225  Hepatocellular carcinoma
nle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100606846 (WNT3A)
   04390 Hippo signaling pathway
    100606846 (WNT3A)
   04150 mTOR signaling pathway
    100606846 (WNT3A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100606846 (WNT3A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100606846 (WNT3A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100606846 (WNT3A)
   05206 MicroRNAs in cancer
    100606846 (WNT3A)
   05205 Proteoglycans in cancer
    100606846 (WNT3A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100606846 (WNT3A)
   05226 Gastric cancer
    100606846 (WNT3A)
   05217 Basal cell carcinoma
    100606846 (WNT3A)
   05224 Breast cancer
    100606846 (WNT3A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100606846 (WNT3A)
   05022 Pathways of neurodegeneration - multiple diseases
    100606846 (WNT3A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100606846 (WNT3A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100606846 (WNT3A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:nle00536]
    100606846 (WNT3A)
Glycosaminoglycan binding proteins [BR:nle00536]
 Heparan sulfate / Heparin
  Morphogens
   100606846 (WNT3A)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100606846
NCBI-ProteinID: XP_003275162
Ensembl: ENSNLEG00000014118
UniProt: A0A2I3G281
LinkDB
Position
5
AA seq 352 aa
MAPLGYFLLLCSLKQALGSYPIWWSLAVGPQYSSLGSQPILCASIPGLVPKQLRFCRNYV
EIMPSVAEGIKIGIQECQHQFRGRRWNCTTVHDSLAIFGPVLDKATRESAFVHAIASAGV
AFAVTRSCAEGTAAICGCSSRHQGSPGKGWKWGGCSEDIEFGGMVSREFADARENRPDAR
SAMNRHNNEAGRQAIASHMHLKCKCHGLSGSCEVKTCWWSQPDFRAIGDFLKDKYDSASE
MVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEASPNFCEPNPETGSFGTRDRTCNVS
SHGIDGCDLLCCGRGHNARAERRREKCRCVFHWCCYVSCQECTRVYDVHTCK
NT seq 1059 nt   +upstreamnt  +downstreamnt
atggccccgctcggatacttcttactcctctgcagcctgaagcaggctctgggcagctac
ccgatctggtggtcgctggctgttgggccacagtattcctccctgggctcgcagcccatc
ctgtgcgccagcatcccgggcctcgtccccaagcagctccgcttctgcaggaactacgtg
gagatcatgcccagcgtggccgagggcatcaagattggcatccaggagtgccagcaccag
ttccgcggccgccggtggaactgcaccaccgtccacgacagcctggccatcttcgggccc
gtgctggacaaagctaccagggagtcagcctttgtccacgccattgcctcagccggtgtg
gcctttgcggtgacacgctcatgtgcagaaggcacagccgccatctgtggctgcagcagc
cgccaccagggctcaccaggcaagggctggaagtggggtggctgtagcgaggacatcgag
tttggtgggatggtgtctcgggagttcgccgacgcccgggagaaccggccagatgcccgc
tcagccatgaaccgccacaacaacgaggctgggcgccaggccatcgccagccacatgcac
ctcaagtgcaagtgccacgggctgtcgggcagctgcgaggtgaagacatgctggtggtcg
caacccgacttccgcgccatcggtgacttcctcaaggacaagtacgacagcgcctcggag
atggtggtggagaagcaccgggagtcccgcggctgggtggagaccctgcggccgcgctac
acctacttcaaggtgcccacggagcgcgacctggtctactacgaggcctcgcccaacttc
tgcgagcccaaccccgagacgggctccttcggcacgcgcgaccgcacctgcaacgtcagc
tcgcacggcatcgacggctgcgacctgctgtgctgcggccgcggccacaacgcgcgagcg
gagcggcgccgggagaagtgccgctgcgtgttccactggtgctgctacgtcagctgtcag
gagtgcacgcgcgtctacgacgtgcacacctgcaagtag

KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100607164
Entry
100607164         CDS       T03265                                 

Gene name
WNT10A
Definition
(RefSeq) protein Wnt-10a
  KO
K01357  wingless-type MMTV integration site family, member 10
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04150  mTOR signaling pathway
nle04310  Wnt signaling pathway
nle04390  Hippo signaling pathway
nle04550  Signaling pathways regulating pluripotency of stem cells
nle04916  Melanogenesis
nle04934  Cushing syndrome
nle05010  Alzheimer disease
nle05022  Pathways of neurodegeneration - multiple diseases
nle05165  Human papillomavirus infection
nle05200  Pathways in cancer
nle05205  Proteoglycans in cancer
nle05217  Basal cell carcinoma
nle05224  Breast cancer
nle05225  Hepatocellular carcinoma
nle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100607164 (WNT10A)
   04390 Hippo signaling pathway
    100607164 (WNT10A)
   04150 mTOR signaling pathway
    100607164 (WNT10A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100607164 (WNT10A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100607164 (WNT10A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100607164 (WNT10A)
   05205 Proteoglycans in cancer
    100607164 (WNT10A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100607164 (WNT10A)
   05226 Gastric cancer
    100607164 (WNT10A)
   05217 Basal cell carcinoma
    100607164 (WNT10A)
   05224 Breast cancer
    100607164 (WNT10A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100607164 (WNT10A)
   05022 Pathways of neurodegeneration - multiple diseases
    100607164 (WNT10A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100607164 (WNT10A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100607164 (WNT10A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:nle00536]
    100607164 (WNT10A)
Glycosaminoglycan binding proteins [BR:nle00536]
 Heparan sulfate / Heparin
  Morphogens
   100607164 (WNT10A)
SSDB
Motif
Pfam: wnt Ebola_NP
Other DBs
NCBI-GeneID: 100607164
NCBI-ProteinID: XP_003272426
Ensembl: ENSNLEG00000008992
UniProt: G1RCL4
LinkDB
Position
22a
AA seq 417 aa
MGSAHPRPWLRLRPQPQPRPGLWVLLFFLLLLAAAMPRSAPNDILDLRLPPEPVLNANTV
CLTLPGLSRRQMEVCVRHPDVAASAIQGIQIAIHECQHQFRDQRWNCSSLETRNKIPYES
PIFSRGFRESAFAYAIAAAGVVHAVSNACALGKLKACGCDASRRGDEEAFRRKLHRLQLD
ALQRGKGLSHGVPEHPALPTASPDLQDSWEWGGCSPDMGFGERFSKDFLDSREPHRDIHA
RMRLHNNRVGRQAVMENMRRKCKCHGTSGSCQLKTCWQVTPEFRTVGALLRSRFHRATLI
RPHNRNGGQLEPGPAGAPSPAPGAPGPRRRASPADLVYFEKSPDFCEREPRLDSAGTVGR
LCNKSSAGSDGCGSMCCGRGHNILRQTRSERCHCRFHWCCFVVCEECRITEWVSVCK
NT seq 1254 nt   +upstreamnt  +downstreamnt
atgggcagcgcccaccctcgcccctggctgcggctccgaccccagccccagccgcggcca
gggctctgggtgctcctgttcttcctactgctgctggctgctgccatgcccaggtcagca
cccaatgacattctggacctccgcctccccccggagcccgtgctcaatgccaacacagtg
tgcctaacattgccaggcctgagccggcggcagatggaggtgtgtgtgcgtcaccctgat
gtggctgcctcagccatacagggcatccagattgccattcacgaatgccaacaccaattc
agggaccagcgctggaactgctcaagcctggagactcgcaacaagatcccctatgagagt
cccatcttcagcagaggtttccgagagagcgcttttgcctacgccatcgcggcagctggc
gtggtgcacgccgtgtccaatgcgtgtgccctgggcaaactgaaggcctgtggctgtgat
gcgtcccggcgaggggacgaggaggccttccgtaggaagctgcaccgcttacaactggac
gcactgcagcgtggtaagggcctgagccatggggtcccagaacacccagccctgcccaca
gccagcccagacctgcaggactcctgggagtggggcggctgcagccccgacatgggcttc
ggggagcgcttctctaaggactttctggactcccgggagcctcacagagacatccacgca
agaatgaggcttcacaacaaccgagttgggaggcaggcagtgatggagaacatgcggcgg
aagtgcaagtgccacggcacgtcaggcagctgccagctcaagacgtgctggcaggtgacg
cccgagttccgcaccgtgggggcgctgctgcgcagccgcttccaccgcgccacgctcatc
cggccgcacaaccgcaacggcggccagctggagccgggcccagcgggggcgccctcgccg
gctccgggcgctcctgggccgcgccgacgggccagccccgccgacctggtctacttcgaa
aagtcgcccgacttctgcgagcgcgagccgcgcctggactcggcgggcaccgtgggccgc
ctgtgcaacaagagcagcgccggctcggatggctgcggcagcatgtgctgcggccgcggc
cacaacatactgcgccagacgcgcagcgagcgctgccactgccgcttccactggtgctgc
ttcgtggtctgcgaagagtgccgcatcaccgagtgggtcagcgtctgcaagtga

KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100607954
Entry
100607954         CDS       T03265                                 

Gene name
WNT2B
Definition
(RefSeq) protein Wnt-2b isoform X2
  KO
K00182  wingless-type MMTV integration site family, member 2
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04150  mTOR signaling pathway
nle04310  Wnt signaling pathway
nle04390  Hippo signaling pathway
nle04550  Signaling pathways regulating pluripotency of stem cells
nle04916  Melanogenesis
nle04934  Cushing syndrome
nle05010  Alzheimer disease
nle05022  Pathways of neurodegeneration - multiple diseases
nle05165  Human papillomavirus infection
nle05200  Pathways in cancer
nle05205  Proteoglycans in cancer
nle05217  Basal cell carcinoma
nle05224  Breast cancer
nle05225  Hepatocellular carcinoma
nle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100607954 (WNT2B)
   04390 Hippo signaling pathway
    100607954 (WNT2B)
   04150 mTOR signaling pathway
    100607954 (WNT2B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100607954 (WNT2B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100607954 (WNT2B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100607954 (WNT2B)
   05205 Proteoglycans in cancer
    100607954 (WNT2B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100607954 (WNT2B)
   05226 Gastric cancer
    100607954 (WNT2B)
   05217 Basal cell carcinoma
    100607954 (WNT2B)
   05224 Breast cancer
    100607954 (WNT2B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100607954 (WNT2B)
   05022 Pathways of neurodegeneration - multiple diseases
    100607954 (WNT2B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100607954 (WNT2B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100607954 (WNT2B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:nle00536]
    100607954 (WNT2B)
Glycosaminoglycan binding proteins [BR:nle00536]
 Heparan sulfate / Heparin
  Morphogens
   100607954 (WNT2B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100607954
NCBI-ProteinID: XP_003268034
Ensembl: ENSNLEG00000004104
LinkDB
Position
12
AA seq 299 aa
MRSVGEGAREWIRECQHQFRHHRWNCTTLDRDHTVFGRVMLRSSREAAFVYAISSAGVVH
AITRACSQGELSVCSCDPYTRGRHHDQRGDFDWGGCSDNIHYGVRFAKAFVDAKEKRLKD
ARALMNLHNNRCGRTAVRRFLKLECKCHGVSGSCTLRTCWRALSDFRRTGDYLRRRYDGA
VQVMATQDGANFTAARQGYRRATRTDLVYFDNSPDYCVLDKAAGSLGTAGRVCSKTSKGT
DGCEIMCCGRGYDTTRVTRVTQCECKFHWCCAVRCKECRNTVDVHTCKAPKKAEWLDQT
NT seq 900 nt   +upstreamnt  +downstreamnt
atgcgttcagtgggcgagggtgcccgagaatggatccgagagtgtcagcaccaattccgc
caccaccgctggaactgtaccaccctggaccgggaccacaccgtctttggccgtgtcatg
ctcagaagtagccgagaggcagcttttgtatatgccatctcatcagcaggggtagtccac
gctattactcgtgcctgtagccaaggtgaactgagtgtgtgcagctgtgacccctatacc
cgtggccgacaccatgaccagcgtggggactttgactggggtggctgcagtgacaacatc
cactatggtgtccgttttgccaaggccttcgtggatgccaaggagaagaggcttaaggat
gcccgggccctcatgaacttacataataaccgctgtggtcgcacggctgtgcggcggttt
ctgaagctggagtgtaagtgccatggcgtgagtggttcctgtactctgcgcacctgctgg
cgtgcactctcagatttccgccgcacaggtgattacctgcggcggcgctatgatggggct
gtgcaggtgatggccacccaggatggtgccaacttcaccgcagcccgccaaggctatcgc
cgtgccacccggactgatcttgtctactttgacaactctccagattactgtgtcttggac
aaggctgcaggttccctaggcactgcaggccgtgtctgcagcaagacttcaaaaggaaca
gacggttgtgaaatcatgtgctgtggccgagggtacgacacaactcgagtcacccgtgtt
acccagtgtgagtgcaaattccactggtgctgtgctgtacggtgcaaggaatgcagaaat
actgtggacgtccatacttgcaaggcccccaagaaggcagagtggctggaccagacctga

DBGET integrated database retrieval system