KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100579728Help
Entry
100579728         CDS       T03265                                 

Gene name
GYS1
Definition
(RefSeq) glycogen synthase 1
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle00500  Starch and sucrose metabolism
nle01100  Metabolic pathways
nle04151  PI3K-Akt signaling pathway
nle04152  AMPK signaling pathway
nle04910  Insulin signaling pathway
nle04922  Glucagon signaling pathway
nle04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:nle00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100579728 (GYS1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100579728 (GYS1)
   04152 AMPK signaling pathway
    100579728 (GYS1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100579728 (GYS1)
   04922 Glucagon signaling pathway
    100579728 (GYS1)
 09160 Human Diseases
  09166 Endocrine and metabolic diseases
   04931 Insulin resistance
    100579728 (GYS1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:nle01003]
    100579728 (GYS1)
Enzymes [BR:nle01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     100579728 (GYS1)
Glycosyltransferases [BR:nle01003]
 Polysaccharide
  Storage polysaccharide
   100579728 (GYS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_5 Glyco_transf_4 Glyco_trans_4_4 Glycos_transf_1 Glyco_trans_1_4
Motif
Other DBs
NCBI-GeneID: 100579728
NCBI-ProteinID: XP_012365133
LinkDB All DBs
Position
10
AA seq 691 aa AA seqDB search
MPLNRTLSMSSLPGLEDWEDEFDLENAVLFEVAWEVANKVGGIYTVLQTKAKVTGDEWGD
NYFLVGPYTEQGVRTQVELLEAPTPALKRTLDSMNSKGCKVGHGVFGRWLIEGGPLVVLL
DVGASAWALERWKGELWDTCNIGVPWYDREANDAVLFGFLTTWFLGEFLAQSEEKPHVVA
HFHEWLAGIGLCLCRARRLPVATIFTTHATLLGRYLCAGAVDFYNNLENFNVDKEAGERQ
IYHRYCMERAAAHCAHVFTTVSQITAIEAQHLLKRKPGRGWAESWQKGWLVPGFPHTILS
SPSFLSAQVNGSEQTVVAFFIMPARTNNFNVETLKGQAVRKQLWDTANTVKEKFGRKLYE
SLLVGSLPDMNKMLDKEDFTMMKRAIFATQRQSFPPVCTHNMLDDSSDPILTTIRRIGLF
NSSADRVKVIFHPEFLSSTSPLLPVDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPS
ISTNLSGFGCFMEEHIADPSAYGIYILDRRFRSLDDSCSQLTSFLYSFCQQSRRQRIIQR
NRTERLSDLLDWKYLGRYYMSARHMALSKAFPEHFTYEPNEADAAQGYRYPRPASVPPSP
SLSRHSSPHQSEDEEDPRNGPLEEDGERYDEDEEAAKDRRNIRAPEWPRRASCTSSTSGS
KRNSVDTATSSSLSTPSEPLSPTNSLGEERN
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atgcctttaaaccgcactttgtccatgtcctcactgccaggactggaggactgggaggat
gaattcgacctggagaacgctgtgctcttcgaagtggcctgggaggtggctaacaaggtg
ggtggcatctacacggtactgcagacgaaggcgaaggtgacgggggacgaatggggcgac
aactacttcctggtggggccgtacacggagcagggcgtgaggacccaggtggaactgctg
gaggcccccaccccggccctgaagaggacactggattccatgaacagcaagggctgcaag
gtgggacatggtgtattcgggcgctggctgatcgagggaggccctctggtggtgctcttg
gacgtgggtgcctcagcttgggccctggagcgctggaagggagagctctgggatacctgc
aacatcggggtgccatggtacgaccgcgaggccaacgacgctgtcctctttggctttctg
accacctggttcctgggtgagttcctggcgcagagtgaggagaagccacacgtggttgct
cacttccatgagtggctggcaggcattggactctgcctgtgtcgtgcccggcgactgcct
gtagcaaccatcttcaccacccatgccacgctgctggggcgctacctgtgtgccggtgcc
gtggacttctacaacaacctggagaacttcaatgtggacaaggaagcaggggagaggcag
atctatcaccgctactgcatggaaagggcggcagcccactgtgctcacgtcttcactact
gtgtcccagatcaccgccatcgaggcacagcacttgctcaagaggaaaccaggtaggggc
tgggctgaatcttggcagaaaggctggctggttccaggcttcccccacacgatcctgtcc
tccccctcctttctttctgcgcaggtgaacggcagcgagcagacagtggttgccttcttc
atcatgccagcacggaccaacaatttcaacgtggaaaccctcaaaggccaagccgtgcgc
aaacagctttgggacacggccaacacagtgaaggaaaagttcgggaggaagctttacgaa
tccttactggttgggagccttcccgacatgaacaagatgctggataaggaagacttcact
atgatgaagagagccatctttgcaacgcagcggcagtctttcccccctgtgtgcacccac
aatatgctggatgactcctcagaccccatcctgaccaccatccgccgaatcggcctcttc
aatagcagtgccgacagggtgaaggtgattttccacccggagttcctctcctccacaagc
cccctgctccctgtggactatgaggagtttgtccgtggctgtcaccttggagtcttcccc
tcctactatgagccttggggctacacgccggctgagtgcacggttatgggaatccccagt
atctccaccaatctctccggcttcggctgcttcatggaggaacacatcgcagacccctca
gcttacggtatctacattctcgaccggcggttccgcagcctggacgattcctgctcgcag
ctcacctccttcctctacagcttctgtcagcagagccggcggcagcgtatcatccagcgg
aaccgcacggagcgcctctctgaccttctggactggaagtacctaggccggtactatatg
tctgcgcgccacatggcgttgtccaaggcctttccagagcacttcacctacgagcccaac
gaggcggatgcggcccaggggtaccgctacccacggccagcctcagtgccaccgtcgccc
tcgctgtcacgacactccagcccgcaccagagtgaggacgaggaggatcctcggaacggg
ccgctggaggaagacggcgagcgctacgatgaggacgaggaggctgccaaggaccggcgc
aacattcgtgcaccagagtggccgcgccgagcgtcctgcacctcctccaccagcgggagc
aagcgcaactctgtggacacggccacctccagctcactcagcaccccgagcgagcccctc
agccccaccaactccctgggtgaggagcgtaactaa

DBGET integrated database retrieval system