KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100580071
Entry
100580071         CDS       T03265                                 

Gene name
FZD2
Definition
(RefSeq) frizzled-2
  KO
K02235  frizzled 2
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04150  mTOR signaling pathway
nle04310  Wnt signaling pathway
nle04390  Hippo signaling pathway
nle04550  Signaling pathways regulating pluripotency of stem cells
nle04916  Melanogenesis
nle04934  Cushing syndrome
nle05010  Alzheimer disease
nle05022  Pathways of neurodegeneration - multiple diseases
nle05165  Human papillomavirus infection
nle05200  Pathways in cancer
nle05205  Proteoglycans in cancer
nle05217  Basal cell carcinoma
nle05224  Breast cancer
nle05225  Hepatocellular carcinoma
nle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100580071 (FZD2)
   04390 Hippo signaling pathway
    100580071 (FZD2)
   04150 mTOR signaling pathway
    100580071 (FZD2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100580071 (FZD2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100580071 (FZD2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100580071 (FZD2)
   05205 Proteoglycans in cancer
    100580071 (FZD2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100580071 (FZD2)
   05226 Gastric cancer
    100580071 (FZD2)
   05217 Basal cell carcinoma
    100580071 (FZD2)
   05224 Breast cancer
    100580071 (FZD2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100580071 (FZD2)
   05022 Pathways of neurodegeneration - multiple diseases
    100580071 (FZD2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100580071 (FZD2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100580071 (FZD2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:nle04030]
    100580071 (FZD2)
G protein-coupled receptors [BR:nle04030]
 Frizzled / Smoothened family
  100580071 (FZD2)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 100580071
NCBI-ProteinID: XP_004093004
LinkDB
Position
19
AA seq 565 aa
MRPRSALPRLLLPLLLLPAAGPAQFHGEKGISIPDHGFCQPISIPLCTDIAYNQTIMPNL
LGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLEQAIPPCRSICERARQG
CEALMNKFGFQWPERLRCEHFPRHGAEQICVGQNHSEDGAPALLTTAPPPGLQPGAGGTP
GGPGGGGAPPRYATLEHPFHCPRVLKVPSYLSYKFLGERDCAAPCEPARPDGSMFFSQEE
TRFARLWILTWSVLCCASTFFTVTTYLVDMQRFRYPERPIIFLSGCYTMVSVAYIAGFVL
QERVVCNERFSEDGYRTVVQGTKKEGCTILFMMLYFFSMASSIWWVILSLTWFLAAGMKW
GHEAIEANSQYFHLAAWAVPAVKTITILAMGQIDGDLLSGVCFVGLNSLDPLRGFVLAPL
FVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLERLMVRIGVFSVLYTVPATIVIACY
FYEQAFREHWERSWVSQHCKSLAIPCPAHYTPRMSPDFTVYMIKYLMTLIVGITSGFWIW
SGKTLHSWRKFYTRLTNSRHGETTV
NT seq 1698 nt   +upstreamnt  +downstreamnt
atgcggccccgcagcgccctgccccgcctgctgctgccgctgctgctgctgcccgccgcc
gggccggcccagttccacggggagaagggcatctccatcccggaccacggcttctgccag
cccatctccatcccgctgtgcacggacatcgcctacaaccagaccatcatgcccaacctt
ctgggccacacgaaccaggaggacgcaggcctggaggtgcaccagttctatccgctggtg
aaggtgcagtgctcgcctgaactgcgcttcttcctgtgctccatgtacgcacccgtgtgc
accgtgctggaacaggccatcccgccgtgccgctctatctgtgagcgcgcgcgccagggc
tgcgaagcgctcatgaacaaattcggttttcagtggcccgagcgcctgcgctgcgagcac
ttcccgcgtcacggcgccgagcagatctgcgtgggccagaaccactccgaggacggagcg
cccgcgctactcaccactgcgccgccgccgggactgcagccgggtgccgggggcaccccg
ggtggtccgggcggcggcggtgctcccccgcgctacgccacgctggagcaccccttccac
tgcccgcgcgtcctcaaggtgccatcctatctcagctacaagtttctgggcgagcgtgat
tgtgctgcgccctgcgaacccgcgcggcccgatggttccatgttcttctcacaggaggag
acacgtttcgcgcgcctctggatcctcacctggtcggtgttgtgctgcgcctccaccttc
ttcactgtcaccacgtacttggtagacatgcagcgcttccgctacccagagcggcctatc
atttttctgtcgggctgctacaccatggtgtcggtggcctacatcgccggcttcgtgctc
caggagcgcgtagtgtgcaacgagcgcttctccgaggacggttaccgcacggtggtgcag
ggcaccaagaaggagggctgcaccatcctcttcatgatgctctacttcttcagcatggcc
agctccatctggtgggtcatcctgtcgctcacctggttcctggcagccggcatgaagtgg
ggccacgaggccatcgaggccaactctcagtacttccacctggccgcctgggccgtgccg
gccgtcaagaccatcaccatcctggccatgggccagatcgacggcgacctgctgagcggc
gtgtgcttcgtgggcctcaacagcctggacccgctgcggggctttgtgctagcgccgctc
ttcgtgtacctgttcattggcacgtccttcctcctggccggcttcgtgtcgctcttccgc
atccgcaccatcatgaagcacgacggcaccaagaccgaaaagctggagcggctcatggtg
cgcatcggcgtcttctccgtgctctacacagtgcccgccaccatcgtcatcgcttgctac
ttctacgagcaggccttccgcgagcactgggagcgctcgtgggtgagccagcactgcaag
agcctggccatcccgtgcccggcgcactacacgccgcgcatgtcgcccgacttcacggtc
tacatgatcaaatacctcatgacgctcatcgtgggcatcacgtcgggcttctggatctgg
tcgggcaagacgctgcactcgtggaggaagttctacactcgcctcaccaacagccggcac
ggtgagaccaccgtgtga

KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100588311
Entry
100588311         CDS       T03265                                 

Gene name
FZD4
Definition
(RefSeq) frizzled-4
  KO
K02354  frizzled 4
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04150  mTOR signaling pathway
nle04310  Wnt signaling pathway
nle04390  Hippo signaling pathway
nle04550  Signaling pathways regulating pluripotency of stem cells
nle04916  Melanogenesis
nle04934  Cushing syndrome
nle05010  Alzheimer disease
nle05022  Pathways of neurodegeneration - multiple diseases
nle05165  Human papillomavirus infection
nle05200  Pathways in cancer
nle05205  Proteoglycans in cancer
nle05217  Basal cell carcinoma
nle05224  Breast cancer
nle05225  Hepatocellular carcinoma
nle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100588311 (FZD4)
   04390 Hippo signaling pathway
    100588311 (FZD4)
   04150 mTOR signaling pathway
    100588311 (FZD4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100588311 (FZD4)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100588311 (FZD4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100588311 (FZD4)
   05205 Proteoglycans in cancer
    100588311 (FZD4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100588311 (FZD4)
   05226 Gastric cancer
    100588311 (FZD4)
   05217 Basal cell carcinoma
    100588311 (FZD4)
   05224 Breast cancer
    100588311 (FZD4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100588311 (FZD4)
   05022 Pathways of neurodegeneration - multiple diseases
    100588311 (FZD4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100588311 (FZD4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100588311 (FZD4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:nle04030]
    100588311 (FZD4)
   04090 CD molecules [BR:nle04090]
    100588311 (FZD4)
G protein-coupled receptors [BR:nle04030]
 Frizzled / Smoothened family
  100588311 (FZD4)
CD molecules [BR:nle04090]
 Proteins
  100588311 (FZD4)
SSDB
Motif
Pfam: Frizzled Fz Chol_subst-bind
Other DBs
NCBI-GeneID: 100588311
NCBI-ProteinID: XP_003254585
Ensembl: ENSNLEG00000034493
UniProt: A0A2I3GWH4
LinkDB
Position
15
AA seq 540 aa
MLAMAWRGAGPSVPGAPGGVGLSLGLLLQLLLLLGPARGFGDEEERRCDPIRISMCQNLG
YNVTKMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKINIPIGPC
GGMCLSVKRRCEPVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQP
GEECHSVGTNSDQYIWVKRSLNCVLKCGYDAGLYSRSAKEFTDIWMAVWASLCFISTAFT
VLTFLIDSSRFSYPERPIIFLSMCYNIYSIAYIVRLTVGRERISCDFEEAAEPVLIQEGL
KNTGCAIIFLLMYFFGMASSIWWVILTLTWFLAAGLKWGHEAIEMHSSYFHIAAWAIPAV
KTIVILIMRLVDADELTGLCYVGNQNLDALTGFVVAPLFTYLVIGTLFIAAGLVALFKIR
SNLQKDGTKTDKLERLMVKIGVFSVLYTVPATCVIACYFYEISNWALFQYSADDSNMAVE
MLKIFMSLLVGITSGMWIWSAKTLHTWQKCSNRLVNSGKVKREKRGNGWVKPGKGNETVV
NT seq 1623 nt   +upstreamnt  +downstreamnt
atgctggccatggcctggcggggcgcagggccgagcgtcccgggggcgcccgggggcgtc
ggtctcagtctggggttgctcctgcagttgctgctgctcttggggccggcgcggggcttc
ggggacgaggaggagcggcgctgcgaccccatccgcatctccatgtgccagaacctcggc
tacaacgtgaccaagatgcccaacctggtggggcacgagctgcagacggacgccgagctg
cagctgacaactttcacaccgctcatccagtacggctgctccagccagctgcagttcttc
ctttgttctgtttatgtgccaatgtgcacagagaagatcaacatccccattggcccatgc
ggcggcatgtgtctttcagtcaagagacgctgtgaacccgtcctgaaggaattcggattt
gcctggccagagagtctgaactgcagcaaattcccaccacagaacgaccacaaccacatg
tgcatggaagggccaggtgatgaagaggtgccgttacctcacaaaacccccatccagcct
ggggaagagtgtcactctgtgggaaccaattctgatcagtacatctgggtgaaaaggagc
ctgaactgtgtgctcaagtgtggctatgatgctggcttatacagccgctcagccaaggag
ttcaccgatatctggatggctgtgtgggccagcctgtgcttcatctccactgccttcaca
gtactgaccttcctgatcgattcttctaggttttcctaccctgagcgccccatcatattc
ctcagtatgtgctataatatttatagcattgcttatattgtcaggctgactgtaggccgg
gaaaggatatcctgtgattttgaagaggcagcagaacctgttctcatccaagaaggactt
aagaacacaggatgtgcaataattttcttgctgatgtacttttttggaatggccagctcc
atttggtgggttattctgacactcacttggtttttggcagcaggactcaaatggggtcac
gaagccattgaaatgcacagctcttatttccacattgcagcctgggccatccccgcagtg
aaaaccattgtcatcttgattatgagactggtggatgcagatgaactgactggcctgtgc
tatgttggaaaccaaaatctcgatgccctcaccgggttcgtggtggctcccctctttact
tatttggtgattggaactttgttcattgctgcaggtttggtggccttgttcaaaattcgg
tcaaatcttcaaaaggatgggacaaagacagacaagttagaaagactgatggtcaagatt
ggggtgttctcagtactgtacacagttcctgcaacgtgtgtgattgcctgttatttttat
gaaatctccaactgggcactctttcagtattctgcagatgattccaacatggctgttgaa
atgttgaaaatttttatgtctttgttggtgggcatcacttcaggcatgtggatttggtct
gccaaaactcttcacacgtggcagaagtgttccaacagattggtgaattctggaaaggta
aagagagagaagagaggaaatggctgggtgaagcctgggaaaggcaatgagactgtggta
taa

KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100589091
Entry
100589091         CDS       T03265                                 

Gene name
FZD5
Definition
(RefSeq) frizzled-5
  KO
K02375  frizzled 5/8
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04150  mTOR signaling pathway
nle04310  Wnt signaling pathway
nle04390  Hippo signaling pathway
nle04550  Signaling pathways regulating pluripotency of stem cells
nle04916  Melanogenesis
nle04934  Cushing syndrome
nle05010  Alzheimer disease
nle05022  Pathways of neurodegeneration - multiple diseases
nle05165  Human papillomavirus infection
nle05200  Pathways in cancer
nle05205  Proteoglycans in cancer
nle05217  Basal cell carcinoma
nle05224  Breast cancer
nle05225  Hepatocellular carcinoma
nle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100589091 (FZD5)
   04390 Hippo signaling pathway
    100589091 (FZD5)
   04150 mTOR signaling pathway
    100589091 (FZD5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100589091 (FZD5)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100589091 (FZD5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100589091 (FZD5)
   05205 Proteoglycans in cancer
    100589091 (FZD5)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100589091 (FZD5)
   05226 Gastric cancer
    100589091 (FZD5)
   05217 Basal cell carcinoma
    100589091 (FZD5)
   05224 Breast cancer
    100589091 (FZD5)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100589091 (FZD5)
   05022 Pathways of neurodegeneration - multiple diseases
    100589091 (FZD5)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100589091 (FZD5)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100589091 (FZD5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:nle04030]
    100589091 (FZD5)
G protein-coupled receptors [BR:nle04030]
 Frizzled / Smoothened family
  100589091 (FZD5)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 100589091
NCBI-ProteinID: XP_003254052
Ensembl: ENSNLEG00000029167
UniProt: A0A2I3HUS3
LinkDB
Position
22a
AA seq 585 aa
MARPDPSAPPSLLLLLLAQLVGRAAAASKAPVCQEITVPMCRGIGYNLTHMPNQFNHDTQ
DEAGLEVHQFWPLVEIQCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLM
RQYGFAWPERMSCDRLPVLGRDAEVLCMDYNRSEATTAPPRPFPAKPTLPGPPRAPASGG
ECPAGGPSVCKCREPFVPILKESHPLYNKVRTGQVPNCAVPCYQPSFSADERTFATFWIG
LWSVLCFISTSTTVATFLIDMERFRYPERPIIFLSACYLCVSLGFLVRLVVGHASVACSR
EHNHIHYETTGPALCTIVFLLVYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYAQYF
HLAAWLIPSVKSITALALSSVDGDPVAGICYVGNQNLNSLRGFVLGPLVLYLLVGTLFLL
AGFVSLFRIRSVIKQGGTKTDKLEKLMIRIGIFTLLYTVPASIVVACYLYEQHYRESWEA
ALTCACPGPDAGQPRAKPEYWVLMLKYFMCLVVGITSGVWIWSGKTVESWRRFTSRCCCR
PRRGHKSGGAMAAGDYPEASAALTGRTGPSGPAATYHKQVSLSHV
NT seq 1758 nt   +upstreamnt  +downstreamnt
atggctcggcctgacccatccgcgccgccctcgctgttgctgctgctcctggcgcagctg
gtgggccgggcggctgccgcgtccaaggccccggtgtgtcaggaaatcacggtgcccatg
tgccgcggcatcggctacaacctgacgcacatgcccaaccagttcaaccacgacacgcag
gacgaggcgggcctggaggtgcaccagttctggccgctggtggagatccaatgctcgccg
gacctgcgcttcttcctatgctccatgtacacgcccatctgtctgcccgactaccacaag
ccgctgccgccctgccgctcggtgtgcgagcgcgccaaggccggctgctcgccgctgatg
cgccagtacggcttcgcctggcccgagcgcatgagctgcgaccgcctcccggtgctgggc
cgcgacgccgaggtcctctgcatggattacaaccgcagcgaggccaccacggcgcccccc
aggcctttcccagccaagcccacccttccaggcccgccacgggcgccggcctcggggggc
gaatgccccgctgggggcccgtccgtgtgcaagtgtcgcgagcccttcgtgcccattctg
aaggagtcacacccgctctacaacaaggtgcggacaggccaggtgcccaactgcgcggta
ccctgctaccagccgtccttcagtgccgacgagcgcacgttcgccaccttctggataggc
ctgtggtcggtgctgtgcttcatctccacgtccaccacagtggccaccttcctcatcgac
atggaacgcttccgctatcctgagcgccccatcatcttcttgtcagcctgctacctgtgc
gtgtcgctgggcttcctggtgcgcctggtcgtgggccatgccagcgtggcctgcagccgc
gagcacaaccacatccactacgagaccacgggccctgcactgtgcaccatcgtcttcctc
ctggtctacttcttcggcatggccagctccatctggtgggtcatcctgtcgctcacctgg
ttcctggccgctggcatgaagtggggcaacgaggccatcgcgggctacgcgcagtacttc
cacctggctgcgtggctcatccccagcgtcaagtccatcacggcactggcgctgagctcc
gtggacggggacccagtggccggcatctgctacgtgggcaaccagaacctgaactcgctg
cgcggcttcgtgctgggcccgctggtgctctacctgctggtgggcacgctcttcctgctg
gcgggcttcgtgtcgctcttccgcatccgcagcgtcatcaagcagggcggcaccaagacg
gacaagctggagaagctcatgatccgcatcggcatcttcacgctgctctacacggtgccc
gccagcattgtggtggcctgctacctgtacgagcagcactaccgcgagagctgggaggcg
gcgctcacctgcgcctgcccaggccccgacgccggccagccgcgcgccaagcccgagtac
tgggtgctcatgctcaagtacttcatgtgcctggtggtgggcatcacgtcgggcgtctgg
atctggtcgggcaagacggtggaatcgtggcggcgtttcaccagccgctgctgctgccgc
ccgcggcgcggccacaagagtgggggcgccatggccgccggggactaccccgaggcgagc
gccgcgctcacaggcaggaccgggccgtcgggccccgccgccacctaccacaagcaggtg
tccctgtcgcacgtgtag

KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100589994
Entry
100589994         CDS       T03265                                 

Gene name
FZD3
Definition
(RefSeq) frizzled-3
  KO
K02329  frizzled 3
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04150  mTOR signaling pathway
nle04310  Wnt signaling pathway
nle04360  Axon guidance
nle04390  Hippo signaling pathway
nle04550  Signaling pathways regulating pluripotency of stem cells
nle04916  Melanogenesis
nle04934  Cushing syndrome
nle05010  Alzheimer disease
nle05022  Pathways of neurodegeneration - multiple diseases
nle05165  Human papillomavirus infection
nle05200  Pathways in cancer
nle05205  Proteoglycans in cancer
nle05206  MicroRNAs in cancer
nle05217  Basal cell carcinoma
nle05224  Breast cancer
nle05225  Hepatocellular carcinoma
nle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100589994 (FZD3)
   04390 Hippo signaling pathway
    100589994 (FZD3)
   04150 mTOR signaling pathway
    100589994 (FZD3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100589994 (FZD3)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100589994 (FZD3)
  09158 Development and regeneration
   04360 Axon guidance
    100589994 (FZD3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100589994 (FZD3)
   05206 MicroRNAs in cancer
    100589994 (FZD3)
   05205 Proteoglycans in cancer
    100589994 (FZD3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100589994 (FZD3)
   05226 Gastric cancer
    100589994 (FZD3)
   05217 Basal cell carcinoma
    100589994 (FZD3)
   05224 Breast cancer
    100589994 (FZD3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100589994 (FZD3)
   05022 Pathways of neurodegeneration - multiple diseases
    100589994 (FZD3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100589994 (FZD3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100589994 (FZD3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:nle04030]
    100589994 (FZD3)
G protein-coupled receptors [BR:nle04030]
 Frizzled / Smoothened family
  100589994 (FZD3)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 100589994
NCBI-ProteinID: XP_003272969
Ensembl: ENSNLEG00000016642
UniProt: G1S3V5
LinkDB
Position
8
AA seq 666 aa
MAVTWIVFSFWPLTVFMGHIGGHSLFSCEPITLRMCQDLPYNTTFMPNLLNHYDQQTAAL
AMEPFHPMVNLDCSRDFRPFLCALYAPICMEYGRVTLPCRRLCQRAYSECSKLMEMFGVP
WPEDMECSRFPDCDEPYPRLVDLNLAGEPTEGAPVAVQRDYGFWCPRELKIDPDLGYSFL
HVRDCSPPCPNMYFRREELSFARYFIGLISIICLSATLFTFLTFLIDVTRFRYPERPIIF
YAVCYMMVSLIFFIGFLLEDRVACNASIPAQYKASTVTQGSHNKACTMLFMILYFFTMAG
SVWWVILTITWFLAAVPKWGSEAIEKKALLFHASAWGIPGTLTIILLAMNKIEGDNISGV
CFVGLYDVDALRYFVLAPLCLYVVVGVSLLLAGIISLNRVRIEIPLEKENQDKLVKFMIR
IGVFSILYLVPLLVVIGCYFYEQAYRGIWETTWIQERCREYHIPCPYQVTQMSRPDLILF
LMKYLMALIVGIPSVFWVGSKKTCFEWASFFHGRRKKEIVNESRQVLQEPDFAQSLLRDP
NTPIIRKSRGTSTQGTSTHASSTQLAMVDDQRSKAGSIHSKVSSYHGSLHRSRDGRYTPC
SYRGMEERLPHGSMSRLTDHSRHSSSHRLNEQSRHSSIRDLSNNPMTHITHGTSMNRVIE
EDGTSA
NT seq 2001 nt   +upstreamnt  +downstreamnt
atggctgtgacttggattgtcttctctttttggcccttgactgtgttcatggggcatata
ggtgggcacagtttgttttcttgtgaacctattaccttgaggatgtgccaagatttgcct
tataatactaccttcatgcctaatcttctaaatcattatgaccaacagacagcagcttta
gcaatggagccattccaccctatggtgaatctggattgttctcgagatttccggcctttt
ctttgtgcactctatgctcctatttgtatggaatatggacgtgtcacacttccctgtcgt
aggctgtgtcagcgggcttacagtgagtgttcgaagctcatggagatgtttggtgttcct
tggcctgaagatatggaatgcagtaggttcccagattgtgatgagccgtatcctcgactc
gtggatctgaatttagctggagaaccaactgaaggagctccagtggcagtgcagagagac
tatggtttttggtgtccccgagagttaaaaattgatcctgatctgggttattcttttctg
cacgtgcgtgattgttcacctccttgtccaaatatgtacttcaggagagaagaactgtca
tttgctcgctatttcatcggattgatttcaatcatttgcctctcagccacgttgtttact
tttttaacttttttgattgatgtcacaagattccgttaccctgaaaggcctattatattt
tatgcagtctgctacatgatggtatccttaattttcttcattggatttttgcttgaggat
cgagtagcctgcaatgcatccatccctgcacaatataaggcttccacagtgacacaagga
tctcataataaagcctgtaccatgctttttatgatactctatttttttactatggctggc
agtgtatggtgggtaattcttaccatcacatggtttttagcagctgtgccgaagtggggt
agtgaagctattgagaagaaagcattgctgtttcacgccagtgcatggggcatccccgga
actctaaccatcatccttttagcgatgaataaaattgaaggtgacaatattagtggcgtg
tgttttgttggcctctacgatgttgatgcattgagatattttgttcttgctcccctctgc
ctgtatgtggtagttggggtttctctcctcttagctggcattatatccctaaacagagtt
cgaattgagattccattagaaaaggagaaccaagataaattagtgaagttcatgatccgg
attggtgttttcagcattctttatctcgtaccactcttggttgtaattggatgctacttt
tatgagcaagcttaccgtggcatctgggaaacaacgtggatacaagaacgctgcagagaa
tatcacattccatgcccgtatcaggttactcaaatgagtcgtccagacttgattctcttt
ctgatgaaatacctgatggctctcatagttggcattccctctgtattttgggttggaagc
aaaaagacatgctttgaatgggccagtttttttcatggtcgtaggaaaaaagagatagtg
aatgagagccgacaggtactccaggaacctgattttgctcaatctctcctgagggatcca
aatactcctatcataagaaagtcaaggggaacttccactcaaggaacatccacccatgct
tcttcaactcagctggctatggtggatgatcaaagaagcaaagcgggaagcatccacagc
aaagtgagcagctaccacggcagcctccacagatcacgtgatggcaggtacacgccctgc
agttacagaggaatggaggagagactacctcacggcagcatgtcacgactaacagatcac
tccaggcatagtagttctcatcggctcaatgaacagtcacgacatagcagcatcagagat
ctcagtaataatcccatgactcacatcacacatggcaccagcatgaatcgggttattgaa
gaagacggaaccagtgcttaa

KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100592375
Entry
100592375         CDS       T03265                                 

Gene name
FZD9
Definition
(RefSeq) frizzled-9
  KO
K02842  frizzled 9/10
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04150  mTOR signaling pathway
nle04310  Wnt signaling pathway
nle04390  Hippo signaling pathway
nle04550  Signaling pathways regulating pluripotency of stem cells
nle04916  Melanogenesis
nle04934  Cushing syndrome
nle05010  Alzheimer disease
nle05022  Pathways of neurodegeneration - multiple diseases
nle05165  Human papillomavirus infection
nle05200  Pathways in cancer
nle05205  Proteoglycans in cancer
nle05217  Basal cell carcinoma
nle05224  Breast cancer
nle05225  Hepatocellular carcinoma
nle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100592375 (FZD9)
   04390 Hippo signaling pathway
    100592375 (FZD9)
   04150 mTOR signaling pathway
    100592375 (FZD9)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100592375 (FZD9)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100592375 (FZD9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100592375 (FZD9)
   05205 Proteoglycans in cancer
    100592375 (FZD9)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100592375 (FZD9)
   05226 Gastric cancer
    100592375 (FZD9)
   05217 Basal cell carcinoma
    100592375 (FZD9)
   05224 Breast cancer
    100592375 (FZD9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100592375 (FZD9)
   05022 Pathways of neurodegeneration - multiple diseases
    100592375 (FZD9)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100592375 (FZD9)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100592375 (FZD9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:nle04030]
    100592375 (FZD9)
   04090 CD molecules [BR:nle04090]
    100592375 (FZD9)
G protein-coupled receptors [BR:nle04030]
 Frizzled / Smoothened family
  100592375 (FZD9)
CD molecules [BR:nle04090]
 Proteins
  100592375 (FZD9)
SSDB
Motif
Pfam: Frizzled Fz 7tm_2 Dicty_CAR
Other DBs
NCBI-GeneID: 100592375
NCBI-ProteinID: XP_003276646
Ensembl: ENSNLEG00000018702
UniProt: G1SAN4
LinkDB
Position
17
AA seq 591 aa
MAVAPLRGALLLWQLLAAGGAALEIGRFDPERGRGAAPCQAVEIPMCRGIGYNLTRMPNL
LGHTSQGEAAAELAEFAPLVQYGCHSHLRFFLCSLYAPMCTDQVSTPIPACRPMCEQARL
RCAPIMEQFNFGWPDSLDCARLPTRNDPHALCMEAPENATAGPAEPHKGLGMLPVAPRPA
RPPGDLGPGSDGSGTCENPEKFQYVEKSRSCAPRCGPGVEVFWSRRDKDFALVWMAVWSA
LCFFSTAFTVLTFLLEPHRFQYPERPIIFLSMCYNVYSLAFLIRAVAGAQSVACDQEAGA
LYVIQEGLENTGCTLVFLLLYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEAHGSYFHM
AAWGLPALKTIVILTLRKVAGDELTGLCYVASTDAAALTGFVLVPLSGYLVLGSSFLLTG
FVALFHIRKIMKTGGTNTEKLEKLMVKIGVFSILYTVPATCVIVCYVYERLNMDFWRLRA
TEQPCAAAAGPGGRRDCSLPEGSVPTVAVFMLKIFMSLVVGITSGVWVWSSKTFQTWQSL
CYRKIAASRARAKACRAPGSYGRGTHCHYKAPTVVLHMTKTDPSLENPTHL
NT seq 1776 nt   +upstreamnt  +downstreamnt
atggccgtggcgcctctgcggggggcgctgctgctgtggcagctgctggcggcgggcggc
gcggcactggagatcggccgcttcgacccggagcgcgggcgcggggctgcgccgtgccag
gcggtggagatccccatgtgccgcggcatcggctacaacctgacccgcatgcccaacctg
ctgggccacacgtcgcagggcgaggcggccgccgagctggcggagttcgcgccgctggtg
cagtacggctgccacagccacctgcgcttcttcctgtgctcgctctacgcgcccatgtgc
accgaccaggtctcgacgcccattcccgcctgccggcccatgtgcgagcaggcgcgcctg
cgctgcgcgcccatcatggagcagttcaactttggctggccggactccctcgactgcgcc
cggctgcccacgcgcaacgacccgcacgccctgtgcatggaggcgcccgagaacgccacg
gccggccccgcggagccccacaagggcctgggcatgctgcccgtggcgccgcggcccgcg
cgccctcccggagacctgggcccaggctcggacggcagtggcacctgcgagaatcccgag
aagttccagtacgtggagaagagccgctcgtgcgcaccgcgctgcgggcccggcgtcgag
gtgttctggtcccggcgcgacaaggacttcgcgctggtctggatggccgtgtggtcggcg
ctgtgcttcttctccaccgccttcactgtgctcaccttcttgctggagccccaccgcttc
cagtatcccgagcgccccatcatcttcctctccatgtgctacaacgtctactcgctggcc
ttcctgatccgcgcggtggccggagcgcagagcgtggcctgtgaccaggaggcgggcgcg
ctctacgtgatccaggagggcctggagaacacgggctgcacactggtcttcctgctgctc
tactacttcggcatggccagctcgctttggtgggtggtcctgacgctcacctggttcctg
gcggccgggaagaaatggggccatgaggccatcgaggcccacggcagctacttccacatg
gctgcctggggcctgcccgcgctcaagaccatcgtcatcctgaccctgcgcaaggtagcg
ggggatgagctgaccgggctctgctacgtggccagcacggatgcagcggcgctcacgggc
ttcgtgctggtgcccctctccggctacctggtgctgggcagtagtttcctcctgaccggc
ttcgtggccctcttccacatccgcaagatcatgaagacgggcggcaccaacacagagaag
ctggagaagctcatggtcaagatcggggtcttctccatcctctacacggtgcccgccacc
tgcgtcatcgtttgctacgtctacgaacgcctcaacatggacttctggcgccttcgggcc
acagagcagccatgcgcagcggccgcggggcccggaggccggagggactgctcactgcca
gagggctcggtgcctaccgtggcggtcttcatgctcaaaattttcatgtcactggtggtg
gggatcaccagcggcgtctgggtgtggagctccaagactttccagacctggcagagcctg
tgctaccgcaagatagcagctagccgggcccgggccaaggcctgccgggcccccgggagc
tacggacgtggcacgcactgccactataaggctcccaccgtggtcttgcacatgactaag
acggacccctctctggagaaccccacacacctctag

KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100593717
Entry
100593717         CDS       T03265                                 

Gene name
FZD8
Definition
(RefSeq) frizzled-8
  KO
K02375  frizzled 5/8
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04150  mTOR signaling pathway
nle04310  Wnt signaling pathway
nle04390  Hippo signaling pathway
nle04550  Signaling pathways regulating pluripotency of stem cells
nle04916  Melanogenesis
nle04934  Cushing syndrome
nle05010  Alzheimer disease
nle05022  Pathways of neurodegeneration - multiple diseases
nle05165  Human papillomavirus infection
nle05200  Pathways in cancer
nle05205  Proteoglycans in cancer
nle05217  Basal cell carcinoma
nle05224  Breast cancer
nle05225  Hepatocellular carcinoma
nle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100593717 (FZD8)
   04390 Hippo signaling pathway
    100593717 (FZD8)
   04150 mTOR signaling pathway
    100593717 (FZD8)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100593717 (FZD8)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100593717 (FZD8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100593717 (FZD8)
   05205 Proteoglycans in cancer
    100593717 (FZD8)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100593717 (FZD8)
   05226 Gastric cancer
    100593717 (FZD8)
   05217 Basal cell carcinoma
    100593717 (FZD8)
   05224 Breast cancer
    100593717 (FZD8)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100593717 (FZD8)
   05022 Pathways of neurodegeneration - multiple diseases
    100593717 (FZD8)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100593717 (FZD8)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100593717 (FZD8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:nle04030]
    100593717 (FZD8)
G protein-coupled receptors [BR:nle04030]
 Frizzled / Smoothened family
  100593717 (FZD8)
SSDB
Motif
Pfam: Frizzled Fz PhaG_MnhG_YufB
Other DBs
NCBI-GeneID: 100593717
NCBI-ProteinID: XP_030653954
LinkDB
Position
18
AA seq 687 aa
MEWGYLLEVTSLLAALALLQRSSGAAAASAKELACQEITVPLCKGIGYNYTYMPNQFNHD
TQDEAGLEVHQFWPLVEIQCSPDLKFFLCSMYTPICLEDYKKPLPPCRSVCERAKAGCAP
LMRQYGFAWPDRMRCDRLPEQGNPDTLCMDYNRTDLTTAAPSPPRRLPPPPPGEQPPSGS
GHGRPPGARPPHRGGGRGGGGGDAAAPPARGGGGGKARPPGGGAAPCEPGCQCRAPMVSV
SSERHPLYNRVKTGQIANCALPCHNPFFSQDERAFTVFWIGLWSVLCFVSTFATVSTFLI
DMERFKYPERPIIFLSACYLFVSVGYLVRLVAGHEKVACSGGAPGAGGAGGAGGAAAGAG
AAGAGAGGPGGRGEYEELGAVEQHVRYETTGPALCTVVFLLVYFFGMASSIWWVILSLTW
FLAAGMKWGNEAIAGYSQYFHLAAWLVPSVKSIAVLALSSVDGDPVAGICYVGNQSLDNL
RGFVLAPLVIYLFIGTMFLLAGFVSLFRIRSVIKQQDGPTKTHKLEKLMIRLGLFTVLYT
VPAAVVVACLFYEQHNRPRWEATHNCPCLRDLQPDQARRPDYAVFMLKYFMCLVVGITSG
VWVWSGKTLESWRSLCTRCCWASKGAAVGGGAGATAAGGGGGPGGGGGGGPGGGGGSLYS
DVSTGLTWRSGTASSVSYPKQMPLSQV
NT seq 2064 nt   +upstreamnt  +downstreamnt
atggagtggggttacctgttggaagtgacctcgctgctggccgccttggcgctgctgcag
cgctctagcggcgcggcggccgcctcggccaaggagctggcgtgccaagagatcaccgtg
ccgctgtgtaagggcatcggctacaactacacctacatgcccaaccagttcaaccacgac
acgcaggacgaggcgggcctggaagtgcaccagttctggccgctggtggagatccagtgc
tcgcccgatctcaagttcttcctgtgcagcatgtacacgcccatctgcctggaggactac
aagaagccgctgccgccctgccgctcggtgtgcgagcgcgccaaggccggctgcgcgccg
ctcatgcgccagtacggcttcgcctggcccgaccgcatgcgctgcgaccggctgcccgag
cagggcaaccctgacacgctgtgcatggactacaaccgcaccgacctcaccaccgccgcg
cccagcccgccgcgccgcctgccgccgccgccgcccggcgagcagccgccttcgggcagc
ggccacggccgcccgccgggggctaggcccccgcaccgcggcggcggcaggggcggtggc
ggcggggacgcggcggcgcccccagctcgcggcggcggtggcgggaaggcgcggccccct
ggcggcggcgcggctccctgcgagcccgggtgccagtgccgcgcgcccatggttagcgtg
tccagcgagcgccacccgctctacaaccgcgtcaagacaggccagatcgctaactgcgcg
ctgccctgccacaaccccttcttcagccaggacgagcgcgccttcaccgtcttctggatc
ggcctgtggtcggtgctctgcttcgtgtcgactttcgccaccgtctccaccttcctcatc
gacatggagcgcttcaagtacccggagcggcccatcatctttctctcggcctgctacctc
ttcgtgtcggtgggctacctagtgcgcctggtggcgggccacgagaaggtggcgtgcagc
ggtggcgcgccgggcgcggggggcgctgggggcgcgggcggcgcggcagctggcgcgggc
gcggcgggcgcgggcgcgggcggcccgggcgggcgcggcgagtacgaggagctgggcgcg
gtggagcagcacgtgcgctacgagaccaccggccccgcgctgtgcaccgtggtcttcttg
ctggtctacttcttcggcatggccagctccatctggtgggtgatcttgtcgctcacgtgg
ttcctggcggccggcatgaagtggggcaacgaagccatcgccggctactcgcagtacttc
cacctggccgcgtggcttgtgcccagcgtcaagtccatcgcggtgctggcgctcagctcg
gtggacggcgacccagtggcgggcatttgctacgtgggcaaccagagcctggacaacctg
cgcggcttcgtgctggcgccgctggtcatctacctcttcatcggcaccatgttcctgctg
gccggcttcgtgtctctcttccgcatccgctcggtcatcaagcaacaggacggccccacc
aagacgcacaagctggagaagctgatgatccgcctgggcctgttcaccgtgctctacacc
gtgcccgccgcggtggtggtcgcctgcctcttctacgagcagcacaaccgcccgcgttgg
gaggccacgcacaactgcccgtgcctgcgggacctgcagcccgaccaggcacgcaggccc
gactacgccgtcttcatgctcaagtacttcatgtgcctagtggtgggcatcacctccggc
gtgtgggtctggtccggcaagacgctggagtcctggcgctccttgtgcacccgctgctgc
tgggccagcaagggcgccgcggtgggcgggggcgcgggcgccacggccgcggggggtggc
ggcgggcccgggggcggcggcggcgggggaccgggcggcggcgggggctccctttacagc
gacgtcagcaccggcctgacgtggcggtcgggcacggccagctccgtgtcttatccaaag
cagatgccattgtcccaagtctga

KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100597685
Entry
100597685         CDS       T03265                                 

Gene name
FZD7
Definition
(RefSeq) frizzled-7
  KO
K02432  frizzled 1/7
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04150  mTOR signaling pathway
nle04310  Wnt signaling pathway
nle04390  Hippo signaling pathway
nle04550  Signaling pathways regulating pluripotency of stem cells
nle04916  Melanogenesis
nle04934  Cushing syndrome
nle05010  Alzheimer disease
nle05022  Pathways of neurodegeneration - multiple diseases
nle05165  Human papillomavirus infection
nle05200  Pathways in cancer
nle05205  Proteoglycans in cancer
nle05217  Basal cell carcinoma
nle05224  Breast cancer
nle05225  Hepatocellular carcinoma
nle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100597685 (FZD7)
   04390 Hippo signaling pathway
    100597685 (FZD7)
   04150 mTOR signaling pathway
    100597685 (FZD7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100597685 (FZD7)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100597685 (FZD7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100597685 (FZD7)
   05205 Proteoglycans in cancer
    100597685 (FZD7)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100597685 (FZD7)
   05226 Gastric cancer
    100597685 (FZD7)
   05217 Basal cell carcinoma
    100597685 (FZD7)
   05224 Breast cancer
    100597685 (FZD7)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100597685 (FZD7)
   05022 Pathways of neurodegeneration - multiple diseases
    100597685 (FZD7)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100597685 (FZD7)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100597685 (FZD7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:nle04030]
    100597685 (FZD7)
G protein-coupled receptors [BR:nle04030]
 Frizzled / Smoothened family
  100597685 (FZD7)
SSDB
Motif
Pfam: Frizzled Fz Dicty_CAR
Other DBs
NCBI-GeneID: 100597685
NCBI-ProteinID: XP_030659346
Ensembl: ENSNLEG00000035997
LinkDB
Position
22a
AA seq 574 aa
MRDPGAAAPRSSLGLCALVLALLGALFAGAGAQPYHGEKGISVPDHGFCQPISIPLCTDI
AYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLDQAIPPC
RSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGPGGGPTAYP
TAPYLPDLPFTALPPGASDGRGRPAFPFSCPRQLKVPPYLGYRFLGERDCGAPCEPGRAN
GLMYFKEEERRFARLWVGVWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFLSGCYFMVA
VAHVAGFLLEDRAVCVERFSDDGYRTVAQGTKKEGCTILFMVLYFFGMASSIWWVILSLT
WFLAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQVDGDLLSGVCYVGLSSVDA
LRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLEKLMVRIGVFSVLYTV
PATIVLACYFYEQAFREHWERTWLLQTCKSYAVPCPPGHFPPMSPDFTVFMIKYLMTMIV
GITTGFWIWSGKTLQSWRRFYHRLSHSSKGETAV
NT seq 1725 nt   +upstreamnt  +downstreamnt
atgcgggaccccggcgcggccgctccgcgctcgtccctgggcctctgtgccctggtgctg
gcgctgctgggcgcgctgttcgcgggcgccggggcgcagccgtaccacggagagaagggc
atctccgtgccggaccacggcttctgccagcccatctccatcccgctgtgcacggacatc
gcctacaaccagaccatcctgcccaacctgctgggccacacgaaccaagaggacgcgggc
ctcgaggtgcaccagttctacccgttggtgaaggtgcagtgttctcccgaactccgcttc
ttcctgtgctccatgtatgcgcccgtgtgcaccgtgctcgatcaggccatcccgccgtgt
cgttctctgtgcgagcgcgcccgccagggctgcgaggcgctcatgaacaagttcggcttc
cagtggcccgagcggctgcgctgcgagaacttcccggtgcacggcgcgggcgagatctgc
gtgggccagaacacgtcggacggctccgggggcccaggtggcggccccactgcctaccct
actgcgccctacctaccagacctgcccttcaccgcgctgcccccgggggcctcagatggc
agggggcgtcccgccttccccttctcatgcccccgtcagctcaaggtgcccccctacctg
ggctaccgcttcctgggtgagcgcgattgcggcgccccgtgcgaaccgggccgtgccaac
ggcctgatgtactttaaggaggaggagaggcgcttcgcccgcctctgggtgggcgtgtgg
tcggtgctgtgctgcgcctcgacgctctttaccgttctcacctacctggtggacatgcgg
cgcttcagctacccagagcggcccatcatcttcctgtcgggctgctacttcatggtggcc
gtggcgcacgtggccggcttccttctggaggaccgcgccgtgtgcgtggagcgcttctcg
gacgatggctaccgcacggtggcgcagggcaccaagaaggagggctgcaccatcctcttt
atggtgctctacttcttcggcatggccagctccatctggtgggtcattctgtctctcact
tggttcctggcggccggcatgaagtggggccacgaggccatcgaggctaactctcagtac
ttccacctggccgcgtgggccgtgcccgccgtcaagaccatcactatcctggccatgggc
caggtagacggggacctgctcagcggggtgtgctacgttggcctgtccagtgtggacgca
ctgcggggcttcgtgctggcgcctctgttcgtctacctcttcatcggcacgtccttcctg
ctggccggcttcgtgtccctcttccgtatccgcaccatcatgaaacatgacggcaccaag
accgagaagctggagaagctcatggtgcgcatcggcgtcttcagcgtgctctacacagtg
cccgccaccatcgtcttggcctgctacttctacgagcaggccttccgcgagcactgggag
cgcacctggctcctgcagacgtgcaagagctatgccgtgccctgccctcccggccacttc
ccgcccatgagccccgacttcaccgtcttcatgatcaagtacctgatgaccatgatcgtg
ggcatcaccactggcttctggatctggtcgggcaagaccctgcagtcgtggcgccgcttc
taccacagacttagccacagcagcaagggggagactgcggtatga

KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100603705
Entry
100603705         CDS       T03265                                 

Gene name
FZD6
Definition
(RefSeq) frizzled-6
  KO
K02376  frizzled 6
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04150  mTOR signaling pathway
nle04310  Wnt signaling pathway
nle04390  Hippo signaling pathway
nle04550  Signaling pathways regulating pluripotency of stem cells
nle04916  Melanogenesis
nle04934  Cushing syndrome
nle05010  Alzheimer disease
nle05022  Pathways of neurodegeneration - multiple diseases
nle05165  Human papillomavirus infection
nle05200  Pathways in cancer
nle05205  Proteoglycans in cancer
nle05217  Basal cell carcinoma
nle05224  Breast cancer
nle05225  Hepatocellular carcinoma
nle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100603705 (FZD6)
   04390 Hippo signaling pathway
    100603705 (FZD6)
   04150 mTOR signaling pathway
    100603705 (FZD6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100603705 (FZD6)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100603705 (FZD6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100603705 (FZD6)
   05205 Proteoglycans in cancer
    100603705 (FZD6)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100603705 (FZD6)
   05226 Gastric cancer
    100603705 (FZD6)
   05217 Basal cell carcinoma
    100603705 (FZD6)
   05224 Breast cancer
    100603705 (FZD6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100603705 (FZD6)
   05022 Pathways of neurodegeneration - multiple diseases
    100603705 (FZD6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100603705 (FZD6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100603705 (FZD6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:nle04030]
    100603705 (FZD6)
G protein-coupled receptors [BR:nle04030]
 Frizzled / Smoothened family
  100603705 (FZD6)
SSDB
Motif
Pfam: Frizzled Fz Folate_rec RseC_MucC Integrin_alpha
Other DBs
NCBI-GeneID: 100603705
NCBI-ProteinID: XP_030651319
Ensembl: ENSNLEG00000003744
LinkDB
Position
16
AA seq 706 aa
MEMFTFLLTCIFLPLVRGHSLFTCEPITVPRCMKMAYNMTFFPNLMGHYDQSIAAVEMEH
FLPLANLECSPNIETFLCKAFVPTCTEQIHVVPPCRKLCEKVYSDCKKLIDTFGIRWPEE
LECDRLQYCDETIPVTFDPHTEFLGPQKKTEQVQRDIGFWCPRHLKTSGGQGYKFLGIDQ
CAPPCPNMYFKSDELEFAKSFIGTVSIFCLCATLFTFLTFLIDVRRFRYPERPIIYYSVC
YSIVSLMYFIGFLLGDSTACNKADEKLELGDTVVLGSQNKACTVLFMLLYFFTMAGTVWW
VILTITWFLAAGRKWSCEAIEQKAVWFHAVAWGTPGFLTVMLLAMNKVEGDNISGVCFVG
LYDLDASRYFVLLPLCLCVFVGLSLLLAGIISLNHVRQVIQHDGRNQEKLKKFMIRIGVF
SGLYLVPLVTLLGCYVYEQVNRITWEITWVSDHCRQYHIPCPYQAKAKARPELALFMMKY
LMTLIVGISAVFWVGSKKTCTEWAGFFKRNRKRDPISESRRVLQESCEFFLKHNSKVKHK
KKHYKPSSHKLKVISKSMGTSTGATANHGTSAVAITSHDYLGQETLTEIQTSPETSMREV
KADGASTPRLREQDCGEPASPAASISRLSGEQVDRKGQAGSVSKSARSDGRISPKSDITD
TGLAQSNNLQVPSSSEPSSLKGSTSLLVHPVSGVRKEQGGGCHSDT
NT seq 2121 nt   +upstreamnt  +downstreamnt
atggaaatgtttacatttttgttgacgtgtatttttctacccctggtaagagggcacagt
ctcttcacctgtgaaccaattactgttcccagatgtatgaaaatggcctacaacatgaca
tttttccctaatctgatgggtcattatgaccagagtattgccgcggtggaaatggagcat
tttcttcctctcgcaaatctggaatgttcaccaaacattgaaactttcctctgcaaagca
tttgtaccaacctgcacagagcaaattcatgtggttccaccttgtcgtaaactttgtgag
aaagtatattctgattgcaaaaaattaattgacacttttgggatccgatggcctgaggag
cttgaatgtgacagattacaatactgtgatgagaccattcctgtaacttttgatccacac
acagaatttcttggtcctcagaagaaaacagaacaagtccaaagagacattggattttgg
tgtccaaggcatcttaagacttctgggggacaaggatataagtttctgggaattgaccaa
tgtgcacctccatgccccaacatgtattttaaaagtgatgagctagagtttgcgaaaagt
tttattggaacagtttcaatattttgtctttgtgcaactctgttcacattccttactttt
ttaattgatgttagaagattcagatacccagagagaccaattatatattactctgtctgt
tacagcattgtatctcttatgtacttcattggatttttactaggcgatagcacagcctgc
aataaggcagatgagaagctagaacttggtgacactgttgtcctaggctctcaaaataag
gcttgcaccgttttgttcatgcttttgtattttttcacaatggctggcactgtgtggtgg
gtgattcttaccattacttggttcttagctgcaggaagaaaatggagttgtgaagccatc
gaacaaaaagcagtgtggtttcatgctgttgcatggggaacaccaggtttcctgactgtt
atgcttcttgctatgaacaaagttgaaggagacaacattagtggagtttgctttgttggt
ctttatgacctggatgcttctcgctactttgtactcttgccactgtgcctttgtgtgttt
gttgggctctctcttcttttagctggcattatttccttaaatcatgttcgacaagtcata
caacatgatggccggaaccaagaaaaactaaagaaattcatgattcgaattggagtcttc
agcggcttgtatcttgtgccattagtgacacttctcggatgttacgtctatgagcaagtg
aacaggattacttgggagataacttgggtctctgatcattgtcgtcagtaccatatccca
tgtccttatcaggcaaaagcaaaagctcgaccagaattggctttatttatgatgaaatac
ctgatgacattaattgttggcatctctgctgtcttctgggttggaagcaaaaagacatgc
acagaatgggctggattttttaaacgaaatcgcaagagagatccaatcagtgaaagtcga
agagtactacaggaatcatgtgagtttttcttaaagcacaattctaaagttaaacacaaa
aagaagcactataaaccaagttcacacaagctgaaggtcatttccaaatccatgggaacc
agcacaggagctacagcaaatcatggcacttctgcagtagcaattactagccatgattac
ctaggacaagaaactttgacagaaatccaaacctcaccagaaacatcaatgagagaggtg
aaagcggacggagctagcacccccaggttaagagaacaggactgtggtgaacctgcctcg
ccagcagcatccatctccagactgtctggggaacaggtcgacaggaagggccaggcaggc
agtgtatctaaaagtgcacggagtgacggaaggattagtccgaagagtgatattactgac
actggcctggcacagagcaacaatttgcaggtccccagttcttcagaaccaagcagcctc
aaaggttccacatctctgcttgttcacccggtttcaggagtgagaaaagagcagggaggt
ggttgtcattcagatacttga

KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100605346
Entry
100605346         CDS       T03265                                 

Gene name
FZD1
Definition
(RefSeq) frizzled-1
  KO
K02432  frizzled 1/7
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04150  mTOR signaling pathway
nle04310  Wnt signaling pathway
nle04390  Hippo signaling pathway
nle04550  Signaling pathways regulating pluripotency of stem cells
nle04916  Melanogenesis
nle04934  Cushing syndrome
nle05010  Alzheimer disease
nle05022  Pathways of neurodegeneration - multiple diseases
nle05165  Human papillomavirus infection
nle05200  Pathways in cancer
nle05205  Proteoglycans in cancer
nle05217  Basal cell carcinoma
nle05224  Breast cancer
nle05225  Hepatocellular carcinoma
nle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100605346 (FZD1)
   04390 Hippo signaling pathway
    100605346 (FZD1)
   04150 mTOR signaling pathway
    100605346 (FZD1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100605346 (FZD1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100605346 (FZD1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100605346 (FZD1)
   05205 Proteoglycans in cancer
    100605346 (FZD1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100605346 (FZD1)
   05226 Gastric cancer
    100605346 (FZD1)
   05217 Basal cell carcinoma
    100605346 (FZD1)
   05224 Breast cancer
    100605346 (FZD1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100605346 (FZD1)
   05022 Pathways of neurodegeneration - multiple diseases
    100605346 (FZD1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100605346 (FZD1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100605346 (FZD1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:nle04030]
    100605346 (FZD1)
G protein-coupled receptors [BR:nle04030]
 Frizzled / Smoothened family
  100605346 (FZD1)
SSDB
Motif
Pfam: Frizzled Fz 7tm_2 Dicty_CAR
Other DBs
NCBI-GeneID: 100605346
NCBI-ProteinID: XP_003252449
LinkDB
Position
11
AA seq 649 aa
MAEEEAPKKSRAAGGGASWELCAGALSARLAEEGSGDAGGRRRPPVDPRRLARRLLLLLW
LLEAPLLLGVRAQAAGQGPGQGPGPGQQPPPPPPPQQQQSGQQYNGERGISIPDHGYCQP
ISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSAELKFFLCSMYAPVCT
VLEQALPPCRSLCERARQGCEALMNKFGFQWPDTLKCEKFPVHGAGELCVGQNTSDKGTP
TPSLLPEFWTSNPQHGGGGHRGGFPGGAGASERGKFSCPRALKVPSYLNYHFLGEKDCGA
PCEPTKVYGLMYFGPEELRFSRTWIGIWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFL
SGCYTAVAVAYIAGFLLEDRVVCNDKFAEDGARTVAQGTKKEGCTILFMMLYFFSMASSI
WWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAIKTITILALGQVDGDVLSGVCF
VGLNNVDALRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLEKLMVRIG
VFSVLYTVPATIVIACYFYEQAFRDQWERSWVAQSCKSYAIPCPHLQAGGGAPPHPPMSP
DFTVFMIKYLMTLIVGITSGFWIWSGKTLNSWRKFYTRLTNSKQGETTV
NT seq 1950 nt   +upstreamnt  +downstreamnt
atggctgaggaggaggcgcctaagaagtcccgggccgccggcggtggcgcgagctgggaa
ctttgtgccggggcgctctcggcccggctggcggaggagggcagcggggacgccggtggc
cgccgccgccccccagttgacccccggcggttggcgcgccggctgctgctgctgctttgg
ctgctggaggctccgctgctgctgggggtacgggcccaggcggcgggccaggggccaggc
caggggcccgggccggggcagcaaccgccgccaccgccgccgcctcagcagcaacagagc
gggcagcagtacaacggcgagcggggcatctccatcccggaccacggctattgccagccc
atctccatcccgctgtgcacggacatcgcgtacaaccagaccatcatgcccaacctgctg
ggccacacgaaccaggaggacgcgggcctggaggtgcaccagttctaccctctagtgaaa
gtgcagtgttccgctgagctcaagttcttcctgtgctccatgtacgctcccgtgtgcacc
gtgctagagcaggcgctgccgccctgccgctccctgtgcgagcgcgcgcgccagggctgc
gaggcgctcatgaacaagttcggcttccagtggccagacacgctcaagtgcgagaagttc
ccggtgcacggcgccggcgagctgtgcgtgggccagaacacgtccgacaagggcaccccg
acgccctcgctgcttccagaattctggaccagcaaccctcagcacggcggcggagggcac
cgtggcggcttcccggggggcgccggcgcgtcggagcgaggcaagttctcctgcccgcgc
gccctcaaggtgccctcctacctcaactaccacttcctgggggagaaggactgcggcgca
ccctgtgagccgaccaaggtgtatgggctcatgtacttcgggcccgaggagctgcgcttc
tcgcgcacctggattggcatttggtcagtgctgtgctgcgcctccacgctcttcacggtg
cttacgtacctggtggacatgcggcgcttcagctacccggagcggcccatcatcttcttg
tccggctgttacacggccgtggccgtggcctacatcgccggcttcctcctggaggaccga
gtggtgtgtaacgacaagttcgccgaggacggggcacgcactgtggcgcagggcaccaag
aaagagggctgcaccatcctcttcatgatgctctacttcttcagcatggccagctccatc
tggtgggtgatcctgtcgctcacctggttcctggcggctggcatgaagtggggccacgag
gccatcgaagccaactcacagtattttcacctggccgcctgggctgtgccggccatcaag
accatcaccatcctggcgctgggccaggtggacggcgatgtgctgagcggagtgtgcttc
gtggggcttaacaacgtggacgcgctgcgtggcttcgtgctggcgcccctcttcgtgtac
ctgtttatcggcacgtcctttttgctggccggttttgtgtcgctcttccgcatccgcacc
atcatgaagcacgatggcaccaagaccgagaagctggagaagctcatggtgcgcattggc
gtcttcagcgtgctgtacactgtgccagccaccatcgtcatcgcctgctacttctacgag
caggccttccgggaccagtgggaacgcagctgggtggcccagagctgcaagagctacgct
atcccctgccctcacctccaggcgggcggaggcgccccgccgcacccgcccatgagcccg
gacttcacggtcttcatgatcaagtaccttatgacgctgatcgtgggcatcacgtcgggc
ttctggatctggtccggcaagaccctcaactcctggaggaagttctacacgaggctcacc
aacagcaaacaaggggagactaccgtttga

KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100607762
Entry
100607762         CDS       T03265                                 

Gene name
FZD10
Definition
(RefSeq) frizzled-10
  KO
K02842  frizzled 9/10
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04150  mTOR signaling pathway
nle04310  Wnt signaling pathway
nle04390  Hippo signaling pathway
nle04550  Signaling pathways regulating pluripotency of stem cells
nle04916  Melanogenesis
nle04934  Cushing syndrome
nle05010  Alzheimer disease
nle05022  Pathways of neurodegeneration - multiple diseases
nle05165  Human papillomavirus infection
nle05200  Pathways in cancer
nle05205  Proteoglycans in cancer
nle05217  Basal cell carcinoma
nle05224  Breast cancer
nle05225  Hepatocellular carcinoma
nle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100607762 (FZD10)
   04390 Hippo signaling pathway
    100607762 (FZD10)
   04150 mTOR signaling pathway
    100607762 (FZD10)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100607762 (FZD10)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100607762 (FZD10)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100607762 (FZD10)
   05205 Proteoglycans in cancer
    100607762 (FZD10)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100607762 (FZD10)
   05226 Gastric cancer
    100607762 (FZD10)
   05217 Basal cell carcinoma
    100607762 (FZD10)
   05224 Breast cancer
    100607762 (FZD10)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100607762 (FZD10)
   05022 Pathways of neurodegeneration - multiple diseases
    100607762 (FZD10)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100607762 (FZD10)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100607762 (FZD10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:nle04030]
    100607762 (FZD10)
   04090 CD molecules [BR:nle04090]
    100607762 (FZD10)
G protein-coupled receptors [BR:nle04030]
 Frizzled / Smoothened family
  100607762 (FZD10)
CD molecules [BR:nle04090]
 Proteins
  100607762 (FZD10)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 100607762
NCBI-ProteinID: XP_003276166
Ensembl: ENSNLEG00000018703
UniProt: G1SAN5
LinkDB
Position
10
AA seq 581 aa
MQRPGPRLWLVLQVMGSCAAISSMDMERPGDGKCQPIEIPMCKDIGYNMTRMPNLMGHEN
QREAAIQLHEFAPLVEYGCHGHLRFFLCSLYAPMCTEQVSTPIPACRVMCEQARLKCSPI
MEQFNFKWPDSLDCRKLPNKNDPNYLCMEAPNNGSDEPTRGSGLLPPLFRPQRPHSAQEH
PLKDGGPGRGGCDNPGKFHHVEKSASCAPLCTPGVDVYWSREDKRFAVVWLAIWAVLCFF
SSAFTVLTFLIDPARFRYPERPIIFLSMCYCVYSVGYLIRLFAGAESIACDRDSGQLYVI
QEGLESTGCTLVFLVLYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEANSSYFHLAAWA
IPAVKTILILVMRRVAGDELTGVCYVGSMDVNALTGFVLIPLACYLVIGTSFILSGFVAL
FHIRRVMKTGGENTDKLEKLMVRIGLFSVLYTVPATCVIACYFYERLNMDYWKILAAQHK
CKMNNQTKTLDCLMAASIPAVEIFMVKIFMLLVVGITSGMWIWTSKTLQSWQQVCSRRLK
KKSRRKPASVITSGGIYKKAQHPQKTHHGKYEIPAQPPTCV
NT seq 1746 nt   +upstreamnt  +downstreamnt
atgcagcgcccgggcccccgcctgtggctggtcctgcaggtgatgggctcgtgcgccgcc
atcagctccatggacatggagcgcccgggcgacggcaaatgccagcccatcgagatcccg
atgtgcaaggacatcggctacaatatgactcgcatgcccaacctgatgggccacgagaac
cagcgcgaggcagccatccaactgcacgagttcgcgccgctggtagagtacggctgccac
ggccacctccgcttcttcctgtgctcgctgtacgcgccgatgtgcaccgagcaggtctcc
acccccatccccgcctgccgggtcatgtgcgagcaggcccggctcaagtgctccccgatt
atggagcagttcaacttcaagtggcccgactccctggactgccggaaactccccaacaag
aacgaccccaactacctgtgcatggaggcgcccaacaacggctcggacgagcccacccgg
ggctcgggcctgttaccgccgctgttccggccgcagcggccccacagcgcgcaggagcac
ccgctgaaggacggggggcccgggcgcggcggctgcgacaacccgggcaagttccaccac
gtggagaagagcgcgtcgtgcgcgccgctctgcacgcccggcgtggacgtgtactggagc
cgcgaggacaagcgcttcgccgtggtctggctggccatctgggccgtgctgtgcttcttc
tccagcgccttcaccgtgctcaccttcctcatcgacccggcgcgcttccgctaccccgag
cgccccatcatcttcctctccatgtgctactgcgtctactccgtgggctacctcatccgc
ctcttcgccggcgccgagagcatcgcctgcgaccgggacagcggccagctctatgtcatc
caggagggactggagagcaccggctgcacgctggtcttcctggtcctctactacttcggc
atggccagctcgctgtggtgggtggtcctcacgctcacctggttcctggccgccggcaag
aagtggggccacgaggccatcgaagccaacagcagctacttccacctggcagcctgggcc
atcccggcggtgaagaccatcctgatcctggtcatgcgcagggtggcgggggacgagctc
accggggtctgctacgtgggcagtatggacgtcaacgcgctcaccggcttcgtgctcatc
cccctggcctgctacctggtcatcggcacgtccttcatcctctcgggcttcgtggccctg
ttccacatccggagggtgatgaagacgggcggcgagaacacggacaagctggagaagctc
atggtgcgtatcgggctcttctctgtgctgtacaccgtgccggccacctgtgtgatcgcc
tgctacttttacgaacgcctcaacatggattactggaagatcctggcggcgcagcacaag
tgcaaaatgaacaaccagaccaaaaccctggactgcctgatggccgcctccatccccgcc
gtggagatcttcatggtgaagatctttatgctgctggtggtggggatcaccagcgggatg
tggatttggacctccaagactctgcagtcctggcagcaggtgtgcagccgtaggttaaag
aagaagagccggagaaaaccggccagcgtgatcaccagcggtgggatttacaaaaaagcc
cagcatccccagaaaactcaccacgggaaatatgaaatccctgcccagccgcccacctgc
gtgtga

DBGET integrated database retrieval system