KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100580596Help
Entry
100580596         CDS       T03265                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial-like
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle00020  Citrate cycle (TCA cycle)
nle00190  Oxidative phosphorylation
nle01100  Metabolic pathways
nle01200  Carbon metabolism
nle04714  Thermogenesis
nle04932  Non-alcoholic fatty liver disease (NAFLD)
nle05010  Alzheimer disease
nle05012  Parkinson disease
nle05016  Huntington disease
Module
nle_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
nle_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:nle00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100580596
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    100580596
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    100580596
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100580596
   05012 Parkinson disease
    100580596
   05016 Huntington disease
    100580596
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100580596
Enzymes [BR:nle01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     100580596
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Pyr_redox_2 FAD_binding_3 GIDA Thi4 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 100580596
NCBI-ProteinID: XP_012362352
LinkDB All DBs
Position
5
AA seq 211 aa AA seqDB search
MSGVRGLWRMLSARRLVRVKAWPTVLQTGTRDFHFTVEXNKRASAKVSDSISAQYPVVDH
EFDAVVVGAGGAGLPAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEEGNXR
WHFYDTGKGSDWLGDQDAIHYMVEQAPAAVVELENYGLPFSRTEDGKIYQRAFGGQSLKF
GKGGQARRCCCVADRTGHSILHTLYRRKLRL
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggggtccggggcctgtggcggatgctgagcgctcggcgcctggtgcgggtcaag
gcgtggccaacagtgttgcaaacaggaacccgagattttcacttcactgttgaanggaac
aagagggcatctgctaaagtttcagattccatttctgctcagtatccagtagtggaccat
gaattcgacgcagtggtggtaggcgctggaggggcaggcttgccagctgcatttggcctt
tctgaggcagggtttaatacagcgtgtgttacaaagctgtttcctaccaggtcacacact
gttgcggcgcagggaggaatcaatgctgctctggggaacatggaggagggcaactgaagg
tggcatttctacgacaccgggaagggctccgactggctgggggaccaggatgccatccac
tacatggtggagcaggcccccgctgccgtggtcgagctagaaaattatggcttgccattt
agcagaactgaagatgggaagatttatcagcgtgcatttggtggacagagcctcaagttt
ggaaagggcgggcaggcccgtcggtgctgctgtgtggctgatcggactggccactcaata
ttgcacaccttatacaggagaaaacttagactataa

DBGET integrated database retrieval system