KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100581124Help
Entry
100581124         CDS       T03265                                 

Gene name
HDAC4
Definition
(RefSeq) histone deacetylase 4
  KO
K11406  histone deacetylase 4/5 [EC:3.5.1.98]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04371  Apelin signaling pathway
nle05034  Alcoholism
nle05165  Human papillomavirus infection
nle05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100581124 (HDAC4)
 09160 Human Diseases
  09161 Cancers: Overview
   05203 Viral carcinogenesis
    100581124 (HDAC4)
  09165 Substance dependence
   05034 Alcoholism
    100581124 (HDAC4)
  09172 Infectious diseases: Viral
   05165 Human papillomavirus infection
    100581124 (HDAC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:nle03036]
    100581124 (HDAC4)
Enzymes [BR:nle01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100581124 (HDAC4)
Chromosome and associated proteins [BR:nle03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     100581124 (HDAC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl HDAC4_Gln
Motif
Other DBs
NCBI-GeneID: 100581124
NCBI-ProteinID: XP_012360144
LinkDB All DBs
Position
22a
AA seq 1088 aa AA seqDB search
MSSQSHPDGLSGRDQPVELLNPARVNHMPSTVDVATALPLQVAPSAVPMDLRLDHQFSLP
VAEPALREQQLQQELLALKQKQQIQRQILIAEFQRQHEQLSRQHEAQLHEHIKQQQEMLA
MKHQQELLEHQRKLERHRQEQELEKQHREQKLQQLKNKEKGKESAVASTEVKMKLQEFVL
NKKKALAHRNLNHCISSDPRYWYGKTQHSSLDQSSPPQSGVSTSYNHPVLGMYDAKDDFP
LRKTASEPNLKLRSRLKQKVAERRSSPLLRRKDGPVVTALKKRPLDVTDSACSSAPGSGP
SSPNNSSGSVSAENGIAPTVPSIPAETSLAHRLVAREGSAAPLPLYTSPSLPNITLGLPA
TGPSAGTAGQQDAERLALPALQQRLSLFPGTHLTPYLSTSPLERDGGAAHSPLLQHMVLL
EQPPAQAPLVTGLGALPLHAQSLVGADRVSPSIHKLRQHRPLGRTQSAPLPQNAQALQHL
VIQQQHQQFLEKHKQQFQQQQLHMNKIIPKPSEPGRQPESHPEETEEELREHQALLDEPY
LDRLPGQKEAHAPASVQVKQEPIESDDEEAEPPREVEPGQRQPSEQELLFRQVPDCQLCG
QTLHLHPRQHLGSQEQDTLQAQRSSISSERHVPTSRPAPGPRGPGCPEADGLLLLLASMR
SRAQSSPASATFPVSVQEPPTKPRFTTGLVYDTLMLKHQCTCGSSSSHPEHAGRIQSIWS
RLQETGLRGKCECIRGRKATLEELQTVHSEAHTLLYGTNPLNRQKLDSKKLLGSLASVFV
RLPCGGVGVDSDTIWNEVHSAGAARLAVGCVVELVFKVATGELKNGFAVVRPPGHHAEES
TPMDVHHGNGTQQAFYSDPSVLYMSLHRYDDGNFFPGSGAPDEVGTGPGVGFNVNMAFTG
GLDPPMGDAEYLAAFRTVVMPIASEFAPDVVLVSSGFDAVEGHPTPLGGYNLSARCFGYL
TKQLMGLAGGRIVLALEGGHDLTAICDASEACVSALLGNELDPLPEKVLQQRPNANAVRS
MEKVMEIHSKYWRCLQRATSTVGRSLIEAQTCENEEAETVTAMASLSVGVKPAEKRPDEE
PMEEEPPL
NT seq 3267 nt NT seq  +upstreamnt  +downstreamnt
atgagctcccaaagccatccagatggactttctggccgagaccagccagtggagctgctg
aatcctgcccgcgtgaaccacatgcccagcacggtggatgtggccacggcactgcctctg
caagtggccccctcggcagtgcccatggacctgcgcctggaccaccagttctcactgcct
gtggcagagccggccctgcgggagcagcagctgcagcaggagctcctggcgctcaagcag
aagcagcagatccagaggcagatcctcatcgccgagttccagaggcagcacgagcagctc
tcccggcagcacgaggcgcagctccacgagcacatcaagcaacagcaggagatgctggcc
atgaagcaccagcaggagctgctggaacaccagcggaagctggagaggcaccgccaagag
caggagctggagaagcagcaccgggagcagaagctgcagcagctcaagaacaaggagaag
ggcaaagagagtgccgtggccagcacagaagtgaagatgaagttacaagaatttgtcctc
aataaaaagaaggcgctggcccaccggaatctgaaccactgcatttccagcgaccctcgc
tactggtacgggaaaacgcagcacagttcccttgaccagagttctccaccacagagcgga
gtgtcgacctcctataaccaccctgtcctgggaatgtacgacgccaaagatgacttccct
cttaggaaaacagcttctgaaccgaatctgaaattacggtccaggctaaagcagaaagtg
gctgaaagacggagcagccccctgttacgcaggaaagacgggccagtggtcactgctcta
aaaaagcgtccgttggatgtcacagactccgcgtgcagcagcgccccaggctccggaccc
agctcacccaacaacagctccgggagcgtcagcgcggagaacggtatcgcgcccaccgtc
cccagcatcccggcggagacgagtttggcgcacagacttgtggcgcgagaaggctcggcc
gctccacttcccctctacacgtcaccatccctgcccaacatcacgctgggcctgcctgcc
accggcccttccgctggcacggcgggccagcaggacgccgagagactcgcccttcctgcc
ctccagcagaggctctcccttttccccggcacccacctcactccctacctgagcacctcg
cccttggagcgggacggaggggcagcgcacagccctcttctgcagcacatggtcttactg
gagcagccgccggcacaagcgcccctcgttacaggcctgggagcactgcccctccacgca
cagtccttggttggtgcagaccgggtgtccccctccatccacaagctgcggcagcaccgc
ccgctggggcgcacccagtcagccccgctgccccagaacgcccaggctctgcagcacctg
gtcatccagcagcagcatcagcagtttctggagaaacacaagcagcagttccagcagcag
caactgcacatgaacaagatcattcccaagccaagcgagccaggccggcagccggagagc
cacccggaggagacggaggaggagctccgtgagcaccaggctctgctggacgagccctac
ctggaccggctgccagggcagaaggaggcgcacgcaccggccagcgtgcaggtgaagcag
gagcccattgagagcgacgacgaagaggcggagcccccgcgggaggtggagccgggccag
cgccagcccagtgagcaggagctgctcttcagacaggttcctgactgccagctgtgtggc
cagacgctgcatctccacccccggcagcaccttggaagccaggagcaggacaccctgcaa
gcccagcgcagctccatctcatcggagaggcacgtccccaccagcaggcctgctccaggc
cccagaggtcctgggtgcccggaagctgatgggctgttgctgcttttagcaagcatgagg
tcccgggcgcagtcctcacccgcgtctgccaccttccccgtgtctgtccaggagcccccc
accaagccgaggttcacgacaggccttgtgtatgacacgctgatgctgaagcaccagtgc
acctgtgggagcagcagcagccaccccgagcacgccgggaggatccagagcatctggtcc
cgcctgcaggagacgggcctccggggcaaatgcgagtgcatccgcggacgcaaggccacc
ctggaggagctgcagacggtgcactcggaagcccacaccctcctgtacggcacgaacccc
ctcaaccggcagaaactggacagtaagaaacttctaggctccctcgcctccgtgttcgtc
cggctcccctgcggtggtgttggggtggacagtgacaccatatggaacgaggtgcactcg
gcaggggcagcccgcctggctgtgggctgcgtggtagagctggtcttcaaggtggccaca
ggggagctgaagaatggctttgctgtggtccgcccccctggacatcacgcggaggagagc
acgcccatggacgtgcaccatggaaacgggacgcagcaggctttctacagcgaccccagc
gtcctgtacatgtccctccaccgctacgacgatgggaacttcttcccaggcagcggggct
cctgacgaggtgggcacagggcccggcgtgggtttcaacgtcaacatggctttcaccggc
ggcctggacccccccatgggagatgctgagtacttggcggccttcagaacggtggtcatg
ccgatcgccagcgagtttgccccggacgtggtgctggtgtcatcaggcttcgacgctgtg
gagggccaccccacgcctctcgggggctacaacctctctgccagatgcttcgggtacctg
acgaagcagctgatgggcctggctggcggccggattgtcctggccctcgagggaggccac
gacctgactgccatttgcgatgcctccgaagcatgtgtttctgccttgctgggaaatgag
cttgatcctctcccagaaaaggtcttacagcaaagacccaacgcaaacgctgtccgctcc
atggagaaagtcatggagatccatagcaagtactggcgctgcctgcagcgcgcaacctcc
acagtggggcgttctctgatcgaggctcagacttgcgagaacgaagaagccgagacggtc
accgccatggcctcgctgtccgtgggcgtgaagcctgccgaaaagagaccagacgaggag
cccatggaagaggagccgcccctgtag

DBGET integrated database retrieval system