KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100581326
Entry
100581326         CDS       T03265                                 

Gene name
NLRP4
Definition
(RefSeq) NACHT, LRR and PYD domains-containing protein 4
  KO
K22265  NACHT, LRR and PYD domains-containing protein 4
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Brite
KEGG Orthology (KO) [BR:nle00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nle04131]
    100581326 (NLRP4)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:nle04054]
    100581326 (NLRP4)
Membrane trafficking [BR:nle04131]
 Autophagy
  Other autophagy associated proteins
   Others
    100581326 (NLRP4)
Pattern recognition receptors [BR:nle04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   100581326 (NLRP4)
SSDB
Motif
Pfam: NACHT PYRIN NLRC4_HD2 NOD2_WH LRR_6 AAA_16 VirE AAA_25 AAA_14 ResIII RNA_helicase
Other DBs
NCBI-GeneID: 100581326
NCBI-ProteinID: XP_003277256
Ensembl: ENSNLEG00000010674
UniProt: G1RIF5
LinkDB
Position
10
AA seq 994 aa
MAASFFSDFGLMWYLEELKKEEFRKFKEHLKQMTLHLELKQIPWTEVKKASREELANLLI
KHYEEQQAWNITLRIFQKLDRKDLCMKVMRERTGYTKAYQAHAKQKFSHLWSSKSVTEIH
LYFEEEVKQEECDHLDRLFAPKETGKQPRTVIIQGPQGIGKTTFLMKLMMAWSDNKIFRD
RFLYTFYFCCRELRELPAMSLADLISREWPDPAAPITEIVAQPERLLFIIDSFEELKGGL
NEPDSDLCGDLMEKQPVQVLLSSLLRKKMLPDASLLIAVKPVCPKELRDQVTISEIYQPR
GFNESDRLVYFCCFFKDPKRAMEAFNLVRESEQLFSICQIPLLCWILCTSLKQEMQKGKD
LALTCQSTTSVYSSFVFNLFTPEGAEGPTPQSQRQLKALCSLAAEGMWTDAFEFREDDLR
RNGVVDADIPALLGTKILLKYGERESSYVFLHVCVQEFCAALFYLLKGHFDHPHPAVRCV
QELLVANFKKARRAHWIFLGCFLTGLLNKKEQEKLDAFFGFQLSQEIKQQFHQCLKSLGE
CGDPQGQVDSLAIFYCLFEMQDPAFVKQAVNLLQEANFHIIDNADLVVSAYCLKYCSSLR
KLCFSVQNVFETEDEHSSTSDYSLVCWHHICSVLTTSGHLRELQVEDSTLSESTFVTWCN
QLRHPSCRLQKLGINNVSFSGQSAQLFEVLFYQPDLKYLSLTLTKLSRDDVRSLCDALNY
PAGNVKELALVNCHLSPIDCEVLAGLLTNNKKLAYLNVSCNQLDAGLPLLCAALCSPDAV
LVYLMLAFCHLSEQCCEYISEMLLRNKSVRYLDLSANVLKDEGLKTLCEALKRPDCCLDS
LCLVKCFITADGCEDLASALISNQNLKILQIGCNEIGDVGVQLLCRTLTHPDCRLEILGL
EECGLTSACCKDLASVLTSSKMLQQLNLTLNALDHTGVVVLCEALRHPACALQVLGLRKT
DFDEETQALLMAEEERNPDLTITDEFDTITRVEI
NT seq 2985 nt   +upstreamnt  +downstreamnt
atggcagcctcttttttctccgattttggtcttatgtggtatctggaggagctcaaaaag
gaggagttcaggaaatttaaggaacatctgaagcaaatgactttgcatcttgaactcaag
cagattccctggactgaggtcaaaaaagcatcccgggaagaacttgcaaacctgttgatc
aagcactatgaagaacaacaagcttggaacataaccctaagaatctttcaaaagctggat
agaaaggatctctgcatgaaggtcatgagggagagaacaggatacacaaaggcctatcaa
gctcatgcaaagcagaaattcagccacttatggtccagcaagtctgtcactgagattcac
ctgtactttgaggaggaagtcaagcaagaagaatgtgaccatttggaccgcctttttgct
cccaaggaaactgggaaacagccacgtacagtgatcattcaaggacctcaaggaattgga
aaaacgacattcctgatgaagctgatgatggcctggtcggacaacaagatcttccgggat
agattcctgtacacattctatttctgctgcagagaactgagggagttgccggcaatgagc
ttggctgacttgatttcccgagagtggcctgaccctgctgctcctataacagagatcgtg
gctcaaccggagagactcttgttcatcatcgacagcttcgaagagctgaagggcggcttg
aacgaacccgattcggatctgtgtggcgacttgatggagaaacagccagtgcaggtgctt
ctgagcagtttgctgaggaagaagatgctcccggatgcctccctgctcatcgccgtcaaa
cccgtgtgcccgaaggagctccgggatcaggtgacgatctcagaaatctaccagccccgg
ggattcaacgagagtgataggttagtgtatttctgctgtttcttcaaagacccgaaaaga
gccatggaagccttcaatctcgtaagagaaagtgaacagctgttttccatatgccaaatc
ccgctcctctgctggatcctgtgtaccagtctgaagcaagagatgcagaaaggaaaagac
ctggccctgacctgccagagcactacctctgtgtactcctctttcgtctttaacctgttc
acacccgagggtgccgaggggccgactccgcaaagccagcgccagctgaaggccctgtgc
tccctggctgcagagggcatgtggacagacgcatttgagtttcgtgaagacgacctccgg
agaaatggggttgttgacgctgacatccctgcgctgctgggcaccaagatacttctgaag
tacggggagcgtgagagctcctacgtgttcctccacgtgtgtgtccaggagttctgtgcc
gccttgttctatttgctcaagggccactttgatcatcctcacccagctgtgagatgtgta
caggaattgctagttgccaattttaaaaaagcaaggagagcacattggatttttttgggg
tgttttctaactggccttttaaataaaaaggaacaagaaaaactggacgcgttttttggc
ttccaactgtcccaagagataaagcagcaatttcaccagtgcctgaagagcttaggggag
tgtggcgatcctcagggacaggtggattccttggcgatattttactgtctctttgaaatg
caggatcctgcctttgtgaagcaggcagtgaacctcctccaggaagctaactttcatatt
attgacaacgcggacctggtggtttctgcctactgcttaaaatactgctccagcttgagg
aaactctgtttttccgttcaaaatgtctttgagacagaggatgaacacagctctacgtcg
gattacagccttgtctgttggcatcacatctgctctgtgctcactaccagcgggcacctc
agagagctgcaggtagaggacagcaccctcagcgagtcgacctttgtgacctggtgtaac
cagctgaggcatcccagctgtcgccttcagaagcttggaataaataatgtttccttttct
ggccagagtgctcagctctttgaggtgctcttttatcagccagacttgaaatacctgagc
ctcaccctcacgaaactctctcgtgatgacgtcaggtccctctgtgatgccttgaactac
ccagcaggcaacgtaaaagagctagcgctggtaaattgtcacctctcacccattgattgt
gaagtccttgccggccttctaaccaacaacaagaagctggcgtatctgaatgtatcctgc
aaccagttagacgcaggcctgccccttttgtgtgcagccctgtgcagcccagacgcggtc
ctggtgtacctgatgttggctttctgccacctcagtgagcaatgctgcgaatacatctcg
gaaatgcttctgcgtaacaagagcgtgcgctatctagacctcagcgccaatgtcctgaag
gacgaaggactgaaaaccctctgcgaggccttgaaacgcccagactgctgcctggattcg
ctgtgtttggtaaaatgttttatcaccgctgacggctgtgaagacctcgcctctgctctc
atcagcaatcaaaacctgaagattctgcaaattgggtgcaatgaaatcggtgatgtgggc
gtgcagctgttgtgtcggactctgacgcatccagattgccgcttagagattcttgggttg
gaagaatgtgggttaacgagcgcctgctgtaaggatctcgcgtctgttctcaccagcagt
aagatgctgcagcagctcaacctgaccttgaacgccttggaccacacaggggttgttgtg
ctctgtgaggccctgagacacccagcgtgtgccctgcaggtgctggggctgagaaaaact
gattttgatgaggaaacccaggcacttctgatggctgaggaagagagaaatcctgacctg
accatcacagacgagtttgacacaatcacaagggtagagatctga

DBGET integrated database retrieval system