KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100581640Help
Entry
100581640         CDS       T03265                                 

Gene name
EIF3A
Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit A
  KO
K03254  translation initiation factor 3 subunit A
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle03013  RNA transport
Brite
KEGG Orthology (KO) [BR:nle00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    100581640 (EIF3A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:nle03012]
    100581640 (EIF3A)
Translation factors [BR:nle03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    100581640 (EIF3A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PCI
Motif
Other DBs
NCBI-GeneID: 100581640
NCBI-ProteinID: XP_030662288
Ensembl: ENSNLEG00000016648
LinkDB All DBs
Position
3
AA seq 1392 aa AA seqDB search
MPAYFQRPENALKRANEFLEVGKKQPALDVLYDVMKSKKHRTWQKIHEPIMLKYLELCVD
LRKSHLAKEGLYQYKNICQQVNIKSLEDVVRAYLKMAEEKTEAAKEESQQMVLDIEDLDN
IQTPESVLLSAVSGEDTQDRTDRLLLTPWVKFLWESYRQCLDLLRNNSRVERLYHDIAQQ
AFKFCLQYTRKAEFRKLCDNLRMHLSQIQRHHNQSTAINLNNPESQSMHLETRLVQLDSA
ISMELWQEAFKAVEDIHGLFSLSKKPPKPQLMANYYNKVSTVFWKSGNALFHASTLHRLY
HLSREMRKNLTQDEMQRMSTRVLLATLSIPITPERTDIARLLDMDGIIVEKQRRLATLLG
LQAPPTRIGLINDMVRFNVLQYVVPEVKDLYNWLEVEFNPLKLCERVTKVLNWVREQPEK
EPELQQYVPQLQNNTILRLLQQVSQIYQSIEFSRLTSLVPFVDAFQLERAIVDAARHCDL
QVRIDHTSRTLSFGSDLNYATREDAPIGPHLQSMPSEQIRNQLTAMSSVLAKALEVIKPA
HILQEKEEQHQLAVTAYLKNSRKEHQRILARRQTIEERKERLESLNIQREKEELEQREAE
LQKVRKAEEERLRQEAKEREKERILQEHEQIKKKTVRERLEQIKKTELGAKAFKDIDIED
LEELDPDFIMAKQVEQLEKEKKELQERLKNQEKKIDYFERAKRLEEIPLIKSAYEEQRIK
DMDLWEQQEEERITTMQLEREKALEHKNRMSRMLEDRDLFVMRLKAARQSVYEEKLKQFE
ERLAEERHNRLEERKRQRKEERRITYYREKEEEEQRRAEEQMLKEREERERAERAKREEE
LREYQERVKKLEEVERKKRQRELEIEERERRREEERRLGDSSLSRKDSRWGDRDSEGTWR
KGPEADSEWRRGPPEKEWRRGEGRDEDRSHRRDEERPRRLGDDEDRESSLRPDDDRVPRR
GMDDDRGPRRGPEEDRFSRRGADDDRPSWRNTDDDRPPRRIADEDRGSWRHADDDRPPRR
GLDEDRGSWRTADEDRGPRRGMDDDRGLRRGGADDERSSWRNADDDRGPRRGLDDDRGPR
RGMDDDRGPRRGMDDDRGPRRGMDDDRGPRRGMDDDRGPRRGLDDDRGPWRNADDDRIPR
RGAEDDRGPWRNMDDDRLSRRADDDRFPRRGDDSRPGPWRPLVKPGGWREKEKAREESWG
PPRESRPSEEREWDREKERDRDNQDREENDKDPERERDRERDVDREDRFRRPRDEGGWRR
GPAEESSSWRDSSRRDDRDRDDRRRERDDRRDLRERRDLRDDRDRRGPPLRSEREEVSSW
RRADDRKDDRAEERDPPRRVPPPALSRDRERDRDREREGEKEKASWRAEKDRESLRRTKN
ETDEDGWTTVRR
NT seq 4179 nt NT seq  +upstreamnt  +downstreamnt
atgccggcctattttcagaggccggaaaatgccctcaaacgcgccaacgaatttcttgag
gttggcaaaaagcagcctgctctggatgttctttatgatgttatgaaaagtaaaaaacat
agaacgtggcaaaagatacatgaaccaattatgttgaaatacttggaactttgcgtggat
cttcgcaagagtcacttggcaaaggagggattataccagtataagaacatttgtcaacag
gtgaacataaaatctctagaggatgttgttagggcatatttgaaaatggcagaggaaaaa
actgaagctgctaaagaagaatctcagcagatggtcttagatatagaggatctggataat
attcaaactcctgagagtgttctcctaagtgctgtaagtggtgaagacactcaggatcgt
actgacagattacttttaactccatgggttaaattcctgtgggaatcttacaggcagtgt
ttggaccttcttagaaacaattctagagtagagcgcctgtaccatgatattgcccagcaa
gctttcaaattctgcctccaatacacgcgtaaggctgaattccgtaaactgtgtgacaat
ttgagaatgcacttatcgcagattcagcgccaccataaccaaagtacggcaatcaatctt
aataatccagagagccagtccatgcatttggaaaccagacttgttcagttggacagtgct
atcagcatggaattgtggcaggaagcattcaaagctgtggaagatattcatgggctattc
tccttgtctaaaaaaccacctaaacctcagttgatggcaaattactataacaaagtctca
actgtgttttggaaatctggaaatgctctttttcatgcatctacactccatcgtctttac
catctctctagagaaatgagaaagaatcttacacaagatgagatgcaaagaatgtctact
agagtccttttagccactctttccatccctattactcctgagcgtacggatattgctcga
cttctggatatggatggcattatagttgaaaaacagcgtcgccttgcaacactactaggt
cttcaagccccaccgacacgaattggccttattaatgatatggtcagatttaatgtacta
caatatgttgtcccagaagtgaaagacctttacaattggcttgaagtggaatttaaccca
ttaaaactctgtgagcgagtcacaaaggttctaaattgggttagggaacaacctgaaaag
gaaccggaattgcagcagtatgtgccacaactgcaaaacaacaccatcctccgccttctg
cagcaggtgtcacagatttatcagagcattgagttttctcgtttgacttctctggttcct
tttgttgatgctttccaactggaacgggccatagtagatgcagccaggcattgcgacttg
caggttcgtattgatcacacttctcggaccctgagttttggatctgatttgaattacgct
actcgagaagatgctccgattggtcctcatttgcaaagcatgccttcagagcagataaga
aaccagctgacagccatgtcctcagtacttgcaaaagcacttgaagtcattaaaccagct
catatactgcaagagaaagaagaacagcatcagttggctgttactgcataccttaaaaat
tcacgaaaagagcaccagcggatcctggctcgccgccagacaattgaggaaagaaaagag
cgccttgagagtctgaatattcagcgtgagaaagaagaattggaacagagggaagctgaa
ctccagaaagtacggaaggctgaggaagagaggctgcgccaggaagcaaaggaaagagag
aaggagcgtatcttacaagaacatgaacaaatcaaaaagaaaactgtccgagagcgtttg
gagcagatcaagaaaacagaactgggtgccaaagcattcaaagatattgatattgaagac
cttgaggaattggatccagattttatcatggctaaacaggttgaacaactggagaaagaa
aagaaggaacttcaagaacgcctaaagaatcaagaaaagaagattgactattttgaaaga
gccaaacgtttagaagaaattcctttgataaagagcgcttacgaggaacagagaattaaa
gacatggatctgtgggagcaacaagaggaagaaagaattactaccatgcagctagaacgt
gaaaaggctcttgaacataagaatcgaatgtcacgaatgcttgaagacagagatttattc
gtaatgcgactcaaagctgcacggcagtctgtttatgaggaaaaacttaaacagtttgaa
gagcgattagcagaagaaaggcataatcgattggaagaacggaaaaggcaacgtaaagag
gaacgcaggataacatactatagagaaaaagaagaggaggagcagagaagggcagaagaa
caaatgctaaaagagcgggaagagagagagcgcgctgaacgagcaaaacgcgaggaagag
ctacgagagtatcaggagcgggtgaagaaattagaagaagtggaaaggaaaaaacgccaa
agggagttggaaattgaagaacgagaacgtcgtagagaggaagagagaagacttggcgat
agttcactttctagaaaggactctcgttggggagatagagattcagaaggcacctggaga
aaaggacctgaagcagattctgagtggagaagaggcccgccagagaaggagtggagacgt
ggagaagggcgagatgaggacaggtctcatagaagagatgaagagcggccccggcgtcta
ggggatgatgaagatagagagtcttctcttagaccagacgatgatcgggttccccggcgt
ggcatggatgatgacagaggccctagacgtggtcctgaggaagatcggttctctcgccgt
ggggcagacgatgaccggccttcctggcgtaacacagatgatgacagacctcccagacga
attgctgacgaagacaggggaagctggcgtcatgcggatgatgacagaccacctagacga
ggactggatgaggacagaggaagctggcgaacagctgatgaggacagaggaccaagacgt
gggatggatgatgaccgggggctgaggcgaggaggcgctgacgatgagcgatcatcctgg
cgtaatgctgatgatgaccggggtcccaggcgagggttggatgatgaccggggtcccagg
cgaggcatggatgatgaccggggtcccaggagaggcatggatgatgaccggggtcccagg
agaggcatggatgatgaccggggtcccaggagaggcatggatgatgaccggggtcccagg
cgagggttggatgatgatcgaggaccttggaggaatgccgatgatgacagaattcccagg
cgtggtgcagaggatgacaggggcccttggagaaacatggatgatgatcgcctttcaaga
cgtgctgatgatgatcggtttcccagacggggtgatgactcaagacctggtccttggaga
ccattagtcaagccaggtggatggagagagaaagaaaaagccagagaggagagctggggt
ccacctcgagaatcaaggccatcagaagaacgtgaatgggacagagaaaaagaaagggac
agagataatcaagatcgagaggagaatgacaaggaccctgagagagaaagggacagagag
agagatgtggatcgagaggatcgcttcagaagacctagggatgaaggtggctggagaaga
ggaccagcagaggaatcttcaagctggagagactcaagtcgccgggacgatagggatagg
gatgaccgtcgccgtgagagggatgaccggcgtgatctaagagaaagacgagatctgaga
gacgacagggaccgaagaggacctccgctcagatcagaacgtgaagaagtaagttcttgg
agacgtgctgatgacaggaaagacgaccgggcagaagagcgggaccctcctcgtcgagtt
cctcccccagctctttcaagagaccgagaaagagaccgagaccgagaaagagaaggtgaa
aaagaaaaggcctcatggagagctgagaaagatagggagtctcttcgtcgtactaagaat
gagactgatgaagacggatggaccacagtacgacgttaa

DBGET integrated database retrieval system