KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100582247
Entry
100582247         CDS       T03265                                 

Gene name
SHH
Definition
(RefSeq) sonic hedgehog protein isoform X1
  KO
K11988  sonic hedgehog
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04340  Hedgehog signaling pathway
nle04360  Axon guidance
nle05200  Pathways in cancer
nle05205  Proteoglycans in cancer
nle05217  Basal cell carcinoma
nle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    100582247 (SHH)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100582247 (SHH)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100582247 (SHH)
   05205 Proteoglycans in cancer
    100582247 (SHH)
  09162 Cancer: specific types
   05226 Gastric cancer
    100582247 (SHH)
   05217 Basal cell carcinoma
    100582247 (SHH)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:nle01002]
    100582247 (SHH)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:nle00536]
    100582247 (SHH)
Peptidases and inhibitors [BR:nle01002]
 Cysteine peptidases
  Family C46: hedgehog family
   100582247 (SHH)
Glycosaminoglycan binding proteins [BR:nle00536]
 Heparan sulfate / Heparin
  Morphogens
   100582247 (SHH)
SSDB
Motif
Pfam: HH_signal Hint Peptidase_M15_3 Vint
Other DBs
NCBI-GeneID: 100582247
NCBI-ProteinID: XP_003280908
Ensembl: ENSNLEG00000015404
LinkDB
Position
13
AA seq 465 aa
MGEMLLLARCLLLVLVSSLLVCSGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLG
ASGRYEGKISRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQW
PGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYES
KAHIHCSVKAENSVAAKSGGCFPGSATVHLEQGGTKLVKDLRPGDRVLAADDQGRLLYSD
FLTFLDRDDGAKKVFYVIETREPRERLLLTAAHLLFVAPHNDSAAGEPEASSGSGPPSGG
ALGPRALFASRVRPGQRVYVVAERDGDRRLLPAAVHSVTLREEAAGAYAPLTAQGTILIN
RVLASCYAVIEEHSWAHRAFAPFRLAHALLAALAPARTDRGGDSGGGDRGGGGGRVPLPA
PGAADAPGAGATAGIHWYSQLLYQIGTWLLDSEALHPLGMAVKSS
NT seq 1398 nt   +upstreamnt  +downstreamnt
atgggcgagatgctgctgctggcgagatgtctgctgctagtcctcgtctcctcgctgctg
gtgtgctcaggactggcgtgcggaccgggcagggggttcgggaagaggaggcaccccaaa
aagctgacccctttagcctacaagcagtttatccccaatgtggccgagaagaccctaggc
gccagcggaaggtatgaagggaagatctccagaaactccgagcgatttaaggaactcacc
cccaattacaaccccgacatcatatttaaggatgaagaaaacaccggagcggacaggctg
atgactcagaggtgtaaggacaagttgaacgctttggccatctcggtgatgaaccagtgg
ccaggagtgaaactgcgggtgaccgagggctgggacgaagatggccaccactcagaggag
tctctgcactatgagggccgcgcagtggacatcaccacgtccgaccgcgaccgcagcaag
tacggcatgctggcccgcctggccgtggaggccggcttcgactgggtgtactacgagtcc
aaggcgcacatccactgctcggtgaaagcagagaactcggtggcggccaaatccggaggc
tgcttcccgggctcggccacggtgcacctggagcagggcggcaccaagctggtgaaggac
ctgcgccccggggaccgcgtgctggcggcggacgaccagggccggctgctctacagcgac
ttcctcactttcctggaccgcgacgacggcgccaagaaggtcttctacgtgatcgagacg
cgggagccgcgcgagcgcctgctgctcaccgccgcgcacctgctgtttgtggcgccgcac
aacgactcggccgccggggagcccgaggcgtcctcaggctctgggccgccctccgggggc
gcactggggcctcgagcgctgttcgccagccgcgtgcgcccgggccagcgcgtgtacgtg
gtggccgagcgcgacggggaccgccggctcctgcccgccgctgtgcacagcgtgacccta
cgcgaggaggccgcgggcgcctacgcgccgctcacggcccagggcaccatcctcatcaac
cgggtgctggcctcgtgctacgccgtcatcgaggagcacagctgggcgcaccgggccttc
gcgcccttccgcctggcgcacgcgctcctggctgcactggcgcccgcgcgcacggaccgc
ggcggggacagcggcggcggggaccgcgggggcggcggcggcagagtacccctgcccgcg
cctggtgcggccgacgctccgggtgcgggggccaccgcgggcatccactggtattcgcag
ctgctctaccaaataggcacctggctcctggacagcgaggccctgcacccgctgggcatg
gcggtcaagtccagctga

DBGET integrated database retrieval system