KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100582706Help
Entry
100582706         CDS       T03265                                 

Gene name
SDHB
Definition
(RefSeq) succinate dehydrogenase complex iron sulfur subunit B
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle00020  Citrate cycle (TCA cycle)
nle00190  Oxidative phosphorylation
nle01100  Metabolic pathways
nle01200  Carbon metabolism
nle04714  Thermogenesis
nle04932  Non-alcoholic fatty liver disease (NAFLD)
nle05010  Alzheimer disease
nle05012  Parkinson disease
nle05016  Huntington disease
Module
nle_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
nle_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:nle00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100582706 (SDHB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    100582706 (SDHB)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    100582706 (SDHB)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    100582706 (SDHB)
   05012 Parkinson disease
    100582706 (SDHB)
   05016 Huntington disease
    100582706 (SDHB)
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100582706 (SDHB)
Enzymes [BR:nle01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     100582706 (SDHB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_9 Fer4_7
Motif
Other DBs
NCBI-GeneID: 100582706
NCBI-ProteinID: XP_004093293
LinkDB All DBs
Position
24
AA seq 280 aa AA seqDB search
MAAVVALSLRRRLPATTLSGACLQASRGAQTAAAAAPRIKKFAIYRWDPDKAGDKPHMQT
YEVDLNKCGPMVLDALIKIKNEVDSTLTFRRSCREGICGSCAMNINGGNTLACTRKIDTN
LNKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKXDESQEGKQQYLQSIEEREKL
DGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSL
YRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKEKKASV
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggtggtcgcgctctccttgaggcgccggttaccagccacaacccttagcgga
gcctgcctgcaggcctcccgaggagcccagacagctgcagctgcagctccccgtatcaag
aaatttgccatctatcgatgggacccagacaaggctggagacaaacctcatatgcagact
tatgaagttgaccttaataaatgtggccccatggtattggatgctttaatcaaaattaag
aatgaagttgactctactttgaccttccgaagatcatgcagagaaggcatctgtggctct
tgtgcaatgaacatcaatggaggcaacactctagcttgcacccgaaagattgacaccaac
ctcaataaggtctcaaaaatctaccctcttccacacatgtatgtgataaaggatcttgtt
cccgatttgagcaacttctatgcacagtacaaatccattgagccttatttgaagaagnat
gatgaatctcaggaaggcaagcagcagtatctgcagtccatagaagagcgtgagaaactg
gacgggctctacgagtgcattctctgtgcctgctgtagcaccagctgccccagctactgg
tggaacggagacaaatatctggggcctgcagttcttatgcaggcctatcgctggatgatt
gactccagagacgacttcacagaggagcgcctggccaagctgcaggacccattctctcta
taccgctgccacaccatcatgaactgcacaaggacctgtcctaagggtctgaatccaggg
aaagctattgcggagatcaagaaaatgatggcaacctataaggagaagaaagcttcagtt
taa

DBGET integrated database retrieval system