KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100584028Help
Entry
100584028         CDS       T03265                                 

Gene name
SETD1B
Definition
(RefSeq) SET domain containing 1B
  KO
K11422  histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:nle00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    100584028 (SETD1B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:nle03036]
    100584028 (SETD1B)
Enzymes [BR:nle01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100584028 (SETD1B)
Chromosome and associated proteins [BR:nle03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100584028 (SETD1B)
   HMT complexes
    COMPASS/SET1 complex
     100584028 (SETD1B)
    COMPASS/SET1 complex (yeast)
     100584028 (SETD1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: N-SET SET RRM_1 RRM_5
Motif
Other DBs
NCBI-GeneID: 100584028
NCBI-ProteinID: XP_012365225
LinkDB All DBs
Position
10
AA seq 1927 aa AA seqDB search
MIGPTRKKGHHKLYRYDGQHFSLAMSSNRPVEIVEDPRVVGIWTKNKELELSVPKFKIDE
LYVGPVPPKQVTFAKLNDNIRENFLRDMCKKYGEVEEVEILYNPKTKKHLGIAKVVFATV
RGAKDAVQHLHSTSVMGNIIHVELDTKGETRMRFYELLVTGRYTPQTLPVGELDAVSPIV
NETLQWLSDALKRLKDGGLSAGCGSGSSSVTPNSGGTPFSQDTAYSSCRLDTPNSYGQGT
PLTPRLGTPFSQDSSYSSRQPTPSYLFSQDPTVTFKARRHESKFTDAYNRRHEHHYVHNS
PAVTVVAGATAAFRGSSDLPFGAVGGTGGSSGPPFKAQPQDSATFAHTPPPAQATPAPGF
KSAFSPYQTPVAHFPPPPEEPTATAAFGARDSGEFRRAPAPPPLPPAEPLAKEKPGTPPG
PPPPDTNSMELGGRPTFGWSPEPCDSPGTPTLESSPAGPEKPLDSLDSRIEMLLKEQRTK
LLFLREPDSDTELQMEGSPISSSSSQLSPLAPFGPTSQEEREELGLPGRVLQVAGAPGGL
QAVLGKWFLASRGPGRGPWQGALTAQGAAEYREAPGRPADAPCWRRGIAPGLSAAERTFK
GPPTPIPGLSTQLSKAPRPSLTPPTFTPHHRPGSQLQPRTGQVLGSSPPSDWLCRGATAE
ALSMFTNCQMGSEQSPPPCEVIFRIKNETAGQQSSGEDMEISDDEMPSAPITSADCPKPM
VVTPGAAAVAAPSVLAPTLPLPPPPGFPPLPPPPPPPPPPQPGFPMPPPLPPPPPPPPPA
HPAVTVPPPPLPAPPGVPPPPILPPLPPFPPGLFPVMQVDMSHVLGGQWGGMPMSFQMQT
QVLSRLMTGQGACPYPPFMAAAAAAASAGLQFVNLPPYRGPFSLSNSGPGRGQHWPPLPK
FDPSVPPPGYMPRQEDPHKATVDGVLLVVLKELKAIMKRDLNRKMRMAKASLTPVKSGEH
KDEDRPKPKDRIASCLLESWGKGEGLGYEGLGLGIGLRGAIRLPSFKVKRKEPPDTTSSG
DQKRLRPSTSVDEEDEESERERDRDMADTPCELAKRDPKGVGVRRRPARPLELDSGGEED
EKESLSASSSSSASSSSGSSTTSPSSSASDKEEEQESTEEEEEAEEEEEEEEEEVPRSQL
SSSSTSSTSDKDDDDDDSDDRDESENDDEDTALSEASEKDEGDSDEEETVSIVTSKAEAT
SSSESSESSEFESSSESSPSSSEDEEEVVAREEEEEEEEEEAMVAEESMASAGPEDYEQD
GEEAALALGAPAVDSLGMEEEVDIETEAVAPEKQPPMLDEPPLPVGVEEPADSREPPEEP
GLSQEGAMLLSPEPPAREMEARPPLSPERTPEHDLEVEPEPPTMLPLPLQPPLPPPRPPR
PPSPPPEPETTDASHPSLPPEPAAEDHPPHTPGLCGSLAKSQSTETVPATPGGEPPLSGG
SSGLSLSSPQVPGSPFSYPAPSPSLSSGGLPRTPGRDFSFTPTFSEPSGPLLLPVCPLPT
GRRDERSGPLASPVLLETGLPLPLPLPLPLPLALPAVLRAQARAPPRCRPPPPPPPPPPV
EPTKLPFKELDNQWPSEAIPPGPRGRDEVTEEYMELAKSRGPWRRPPKKRHEDLVPPAGS
PELSPPQPLFRPRSEFEEMTILYDIWNGGIDEEDIRFLCVTYERLLQQDNGMDWLNDTLW
VYHPSTSLSSAKKKKRDDGIREHVTGCARSEGFYTIDKKDKLRYLNSSRASTDEPPADTQ
GMSIPAQPHASTRAGSERRSEQRRLLSSFTGSCDSDLLKFNQLKFRKKKLKFCKSHIHDW
GLFAMEPIAADEMVIEYVGQNIRQVIADMREKRYEDEGIGSSYMFRVDHDTIIDATKCGN
FARFINHSCNPNCYAKVITVESQKKIVIYSKQHINVNEEITYDYKFPIEDVKIPCLCGSE
NCRGTLN
NT seq 5784 nt NT seq  +upstreamnt  +downstreamnt
atgattggcccgactcggaaaaaggggcatcataaactgtaccgctacgatgggcagcat
ttcagcctggcgatgtccagcaaccgcccggtggaaattgtcgaagatccccgggtcgtc
gggatctggaccaaaaacaaggagctggagctgtcggtgcccaaattcaagatcgatgag
ttgtacgtgggcccggtgcctccaaagcaggtgacatttgccaagctgaatgataacatc
cgtgaaaacttcctgagggacatgtgcaagaagtatggggaggtggaggaggtggagatt
ttgtacaaccccaagaccaagaagcacctgggcatcgccaaggtggtctttgccacggtc
cggggagccaaggatgccgttcagcacttgcacagcacttccgtcatgggcaacattatc
cacgtggagctggacaccaaaggggaaacccgaatgcggttctatgaactgttggtcact
ggccgatacaccccccagaccctcccagtgggcgagctggacgctgtctctccaatcgtg
aatgagaccctgcagtggctgtcagatgccctgaagcgcctcaaggatggaggcctgtct
gcaggctgtggctccggctcctcctctgtcacccccaatagcggtgggacacccttctcc
caggacacagcttactccagctgccgcctggacacacccaactcctatggacagggcacc
ccgctcacaccgcgcctgggcacccctttctcacaggactccagctactccagccgccag
cccacaccctcatacctcttcagccaggaccccacagtgaccttcaaggcccggcgccac
gagagcaagttcacggacgcctacaaccgccgccacgaacatcattatgtacacaattct
cccgcggtcaccgtggtggccggggccacagccgccttccggggttcctcggacctcccg
ttcggagcagtcggcggcactgggggcagcagcggcccccccttcaaggctcaaccacag
gattcagccacatttgcccacactccaccacccgcccaagcaacccctgctcctggattc
aagtctgctttctctccgtatcagaccccagtggcccacttccctccacccccagaagaa
cccaccgccacagccgcctttggggcccgagacagtggggagttccggagggcaccagcg
cccccacccctgccacctgctgagcctctggccaaggagaagccaggcacgccacccggc
ccgccgccccccgacaccaacagcatggagctgggcggccggcccaccttcggctggagt
cctgagccctgtgacagccctggcacgcccacgctggagtcgtcccctgcagggccagag
aaacccctcgacagcctggactcgcgcatcgagatgctgctgaaggagcagcgcaccaag
ctgctcttcctgcgggagccagactcagacaccgagctgcagatggagggcagccccatc
tcctcctcctcctcccagctctccccactggccccctttggccccacctcccaggaggaa
cgagaggaacttggcttgcctgggagggtgctgcaggtggctggggctccagggggcctc
caagcagttctggggaagtggtttctggcatcaaggggtccaggcagggggccttggcag
ggggcgttgacagcgcagggagccgccgagtaccgggaagctccgggccggcccgcggac
gccccctgctggcgccggggaatagcgcctgggctttctgcggccgagcgcaccttcaaa
ggtccccccaccccaattccaggcctgtccactcagctctctaaagccccacgcccatcc
ttgacacctcccacattcacccctcaccaccgccctggatcccagctgcagccccgcact
gggcaggtcctgggctccagccctccttctgactggctgtgccgcggcgccacggctgag
gctctgagtatgtttactaactgtcaaatggggtcggagcagagccccccgccctgtgag
gttatctttcggataaaaaatgagacagccggccagcagtcctcaggcgaggacatggag
atctcggatgacgagatgccctcggcccccatcaccagcgccgactgccccaagcccatg
gtggtgaccccaggagcggcagccgtggcagccccttctgtgctggccccaaccctgccg
ctgcccccaccacctggcttccccccgctgcccccaccaccaccaccaccacccccaccg
cagcctggcttccccatgcccccaccgctgcccccaccgccgcccccaccccctccagcc
caccctgctgtgacagtgcccccaccacccttgccagcgccacctggagtcccgccccca
cccattctgccaccactgcccccctttccgccgggcctgttccctgtgatgcaggtggac
atgagccacgtgctgggtggccagtggggcggcatgcccatgtccttccagatgcaaacg
caggtgctcagccggctgatgacgggccagggcgcctgcccctacccgcccttcatggcc
gctgcggccgccgctgcctcagctgggctccagtttgtcaacctgccgccctaccggggc
cccttctccctgagcaactccggcccaggccgcgggcaacactggccaccactgcccaag
tttgacccgtcagtgcctccaccaggctacatgccacgccaggaggacccgcacaaagcc
acggtggatggcgtcctgctggtggtcctcaaagaactcaaggccatcatgaagcgtgac
ctgaaccgcaagatgcggatggccaaggcctcgctgaccccggtgaagtcgggcgagcac
aaggacgaggacaggccgaagcccaaggatcgcatcgcctcgtgcctgctggagtcctgg
ggcaagggcgagggcctgggctacgagggcctgggcctgggcattgggctgcgtggggcc
attcgcctgccctccttcaaggtcaagaggaaggagccaccagacaccacctcatctggc
gaccagaagcggctgcggccctcgacctctgtggatgaggaagatgaagagtccgagcga
gagcgagaccgggatatggcagacaccccctgtgagctcgccaagcgagaccccaagggc
gtgggtgtgcggcggcggccggcgcggcctctggagctggacagtggcggggaggaggac
gagaaggagtcgttgtcggcgtcttcgtcctcatcggcgtcatcatcctccgggtcctca
accacctcaccctcgtcctcggcctccgacaaggaggaggaacaggagagcaccgaggag
gaagaggaggcagaggaggaggaggaggaggaggaagaggaagtccccaggagccagctc
tcctcctcctcaacctcatccacatcagataaggatgacgacgatgatgacagtgatgac
cgggacgagtctgagaacgatgacgaagacacagccctgtcagaggcgagtgagaaggac
gaaggggactcggatgaagaggagacagtgagcattgtaacctccaaggctgaagccacg
tcatccagtgagagttccgagtcttctgagtttgagtcaagctctgagtcctcgccctca
tcctcagaggatgaagaggaggtagtggccagggaagaggaggaagaagaagaggaggag
gaggcgatggtggccgaggaaagcatggcttctgcaggccccgaggactatgagcaggat
ggggaggaagcggctctggccctgggggcgccggcagtggactcattgggcatggaagag
gaggtggacatcgagactgaggctgtggcccctgagaagcagccccccatgctggatgag
ccccccttgcctgtgggtgttgaagagccagcggattccagggagcctcctgaggaacca
ggcctgagccaggaaggggccatgttgctgtctccagagccccctgccagggagatggag
gcccgacccccattgtcccctgagcgaactccagagcatgacctggaagtggagccggag
ccgcctacgatgctcccgttgcccctgcaaccaccattgccgcctccacgaccgccccgg
ccacccagccccccgccggagcctgagaccacagacgcctcacacccatctctccctccg
gagcccgctgccgaggaccaccccccgcatactccaggcctctgtggcagcctggccaag
tcgcagagcacagagacagtgccagccacaccaggcggggagcccccgctatcagggggc
agcagtggcctgtccctgagctctccgcaagtgcccggcagccccttctcctacccagcc
ccgtcccctagcttgagcagtgggggcctccctcggacacctggccgggacttcagcttc
acacccaccttctccgagcccagcgggcctttgctcctgcctgtctgcccgctccccact
ggccgacgcgatgaacgctccgggcccctggcctccccggtgctcctggagacgggtctg
cccctccctctgccccttcccctgcccttgcccttggcattgcccgccgtcttgcgggcc
caggctcgtgccccaccccgctgccgccccccacccccacccccacctcccccacctgta
gagcccaccaagctgccctttaaggagctagacaaccagtggccctctgaggccatccct
ccgggcccccgtgggcgcgatgaggtcactgaggagtacatggagttggccaagagccgg
gggccgtggcgccggccaccaaagaagcgccatgaggacctggtgccacctgcgggctct
cctgaactctcgccaccccagcccctcttccggccccgctcggagtttgaggagatgacc
atcctgtatgacatctggaacggtggcatcgatgaggaggacatccgcttcctgtgtgtc
acctacgagcgactgctacagcaggacaatggcatggactggcttaacgacacgctctgg
gtctaccatccctccaccagcctctcttcagctaagaaaaagaaacgggacgatggcatc
cgcgagcacgtgacgggctgtgcccgcagcgagggcttctataccatcgacaagaaggac
aagctcagatacctcaacagcagccgtgccagcactgatgagccccccgcagacacccag
ggcatgagcatcccagcacagccccacgcctccacgcgggcaggctcggagcggcgttcg
gagcagcgccgcctgctgtcctccttcactggcagctgtgacagcgacctgctcaagttc
aaccagctcaagttccggaagaaaaagctcaagttctgcaagagccacattcacgactgg
ggcttgttcgccatggagcccatcgcggctgacgagatggtcatcgagtacgtgggccag
aatatccgtcaggtgatcgcagacatgcgggagaagcgttacgaggacgagggcatcggg
agcagctacatgttccgggtggaccatgacaccatcatcgatgccaccaagtgcggcaac
ttcgcgcgcttcatcaaccacagctgcaaccccaactgctatgccaaggtgatcacggtg
gagtctcagaagaagatagtcatctactcgaagcagcacatcaacgtcaatgaagagatt
acctatgactataagttccccatcgaggacgtcaagatcccctgcctctgtggctccgag
aactgccgggggaccctcaactag

DBGET integrated database retrieval system