KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100584142Help
Entry
100584142         CDS       T03265                                 

Gene name
GAA
Definition
(RefSeq) glucosidase alpha, acid
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle00052  Galactose metabolism
nle00500  Starch and sucrose metabolism
nle01100  Metabolic pathways
nle04142  Lysosome
Brite
KEGG Orthology (KO) [BR:nle00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100584142 (GAA)
   00500 Starch and sucrose metabolism
    100584142 (GAA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    100584142 (GAA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nle04147]
    100584142 (GAA)
Enzymes [BR:nle01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     100584142 (GAA)
Exosome [BR:nle04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100584142 (GAA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 100584142
NCBI-ProteinID: XP_003280986
LinkDB All DBs
Position
14
AA seq 955 aa AA seqDB search
MGVRHAPCSCRLLAICALVSLATAALLGHILLHDFLLVPRELSGSSPGLEKTHPAHQQGA
SRPGPQDAQAHPGRPRAVPTQCDVPPNSRFDCAPDKAITQEQCEARGCCYIPAKQGLRGV
QMGQPWCFFPPSYPSYKLENLSSSEMGYRATLTRTTPTFFPKDILTLHLDVMMETENRLH
FTIKDPANRRYEVPLETPRVHSRAPSPLYSVEFSEEPFGVIVRRQLDGRVLLNTTVAPLF
FADQFLQLSTSLPSQYITGLAEHLSPLMLSTSWTRITLWNRDLAPTPGANLYGSHPFYLA
LEDGGSAHGVFLLNSNAMDVVLQPSPALSWRSTGGILDVYIFLGPEPKSVVRQYLDVVGY
PFMPPYWGLGFHLCRWGYSSTAITRQVVENMTRAHFPLVSWGRHAVHTHDVIPSLVLSLS
QFPIFPVAGARALGHPHLDGFPSSQDPAISSSGPAGSYRPYDEGLRRGVFITNETGQPLI
GKVWPGSTAFPDFTNPAALAWWEDMVAEFHDQVPFDGMWIDMNEPSNFIRGSEDGCPNNE
LENPPYVPGVVGGTLQAATICASSHQFLSTHYNLHNLYGLTEAIASHRALVKARGTRPFV
ISRSTFAGHGRYAGHWTGDVWSSWEQLASSVPEILQFNLLGVPLVGADVCGFLGNTSEEL
CVRWTQLGAFYPFMRNHNGLLSLPQEPYSFSEPAQQAMRKALALRYALLPHLYTLFHQAH
VAGETVARPLFLEFPKDSSTWTVDHQLLWGEALLITPVLQAGKAEVTGYFPLGTWYDLQT
VPIEALGSLPPPPAAPREPAIHSEGQWVTLPAPLDTINVHLRAGYIIPLQGPGLTTTESR
QQPMALAVALTKGGEARGELFWDDGESLEVLERGAYTQVIFLARNNTIVNELVHVTGEGA
GLQLQKVTVLGVATAPQQVLSNGVPVSNFTYSPDTKALDIPVSLLMGEQFLISWS
NT seq 2868 nt NT seq  +upstreamnt  +downstreamnt
atgggagtgaggcacgcgccctgttcctgccggctcctggccatctgcgccctcgtgtcc
ttggccaccgctgcactcctggggcacatcctgctccatgatttcctgctggttccccga
gagctgagtggctcctccccaggcctggagaagactcacccagctcaccagcagggagcc
agcaggccagggcctcaggatgcccaggcacaccccggccgtcccagagcagtgcccaca
cagtgcgacgtcccccccaacagccgcttcgactgtgcccctgacaaggccatcacccag
gaacagtgcgaggcccgtggctgctgctacatccctgcaaagcagggactgcggggagtc
cagatggggcagccctggtgcttcttcccacccagctaccccagctacaagctggagaac
ctgagctcctctgaaatgggctacagggccaccctgacccgtaccaccccgaccttcttc
cccaaggacatcctgaccttgcatctggacgtgatgatggagactgagaaccgcctccac
ttcacgatcaaagatcccgctaacaggcgctacgaggtgcccttggagaccccgcgtgtc
cacagccgggcgccgtccccactctacagcgtggagttctccgaggagcccttcggggtg
atcgtgcgccggcagctggacggccgtgtgctgctgaacacgacggtggcgcccctgttc
tttgcggaccagttccttcagctgtccacctcgctgccctcgcagtacatcacaggcctc
gccgagcacctcagtcccctgatgctcagcaccagctggaccaggatcaccctgtggaac
cgggacctcgcgcccacgcctggtgcaaacctctatgggtctcaccctttctacctggcg
ctggaggacggcgggtcggcacatggggtgttcctgctgaacagcaatgccatggatgtg
gtcctgcagccgagccccgcccttagctggaggtcgacaggtgggatcctggatgtctac
atcttcctgggcccggagcccaagagcgtggtgcggcagtacctggacgttgtgggatac
ccattcatgccgccatactggggcctgggcttccacctgtgccgctggggctactcctcc
accgccatcacccgccaggtggtggagaacatgaccagggcccacttccccctggtgagt
tggggcaggcatgctgtacacacgcatgatgtcatccccagcctcgtcctctcactgtct
cagtttcccattttccccgtggctggtgccagggctctgggccaccctcaccttgacggg
tttccctcttcccaggatcctgccatcagcagctcgggccctgctgggagctacaggccc
tacgacgagggtctgcggaggggggttttcatcaccaacgagaccggccagccgctgatt
gggaaggtatggcccgggtccactgccttccccgacttcaccaaccccgcagccctggcc
tggtgggaggacatggtggctgagttccatgatcaggtgcccttcgacggcatgtggatt
gacatgaacgagccttccaacttcatcaggggctctgaggacggctgccccaacaatgag
ctggagaacccaccctacgtgcctggggtggttggggggaccctccaggcggccaccatc
tgtgcctccagccaccagttcctctccacacactacaacctgcacaacctctacggcctg
actgaagccatcgcctcccacagggcgctggtgaaggctcgggggacacgcccatttgtg
atctcccgctcgacctttgctggccacggccgatatgccggccactggacgggggacgtg
tggagctcctgggagcagctcgcctcctccgtgccagaaatcctgcagtttaacctgctg
ggggtacctctggtcggggccgacgtctgcggcttcctgggcaacacctcagaggagctg
tgtgtgcgctggacccagctgggggccttctaccccttcatgcggaaccacaacggcctg
ctcagtctgccccaggagccgtacagcttcagcgagccagcccagcaggccatgaggaag
gccctcgccctgcgctacgcactcctcccccacctctacacgctgttccaccaggcccac
gtcgccggggagaccgtggcccggcccctcttcctggagttccccaaggactctagcacc
tggactgtggaccaccagctcctgtggggggaggccctgctcatcaccccagtgctccag
gctgggaaggccgaagtgactggctacttccccttgggcacatggtacgacctgcagacg
gtgccaatagaggcccttggcagtctcccacccccacctgcagctccccgtgagccagcc
atccacagcgaggggcagtgggtgacactgccggcccccctggacaccatcaacgtccac
ctccgggctgggtacatcatccccctgcagggccctggcctcacaaccacagagtcccgc
cagcagcccatggccctggctgtggccctgaccaagggtggggaggcccgaggggagctg
ttctgggatgatggagagagcctggaagtgctggagcgaggggcctacacacaggtcatc
ttcctggccaggaataacacgatcgtgaatgagctggtacatgtgaccggtgagggagct
ggcctgcagctgcagaaggtgactgtcctgggtgtggccacggcaccccagcaggtcctc
tccaacggcgtccctgtctccaacttcacctacagccctgacaccaaggccctggacatc
cctgtctcgctgttgatgggagagcagtttctcatcagctggtcttag

DBGET integrated database retrieval system