KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100584442Help
Entry
100584442         CDS       T03265                                 

Gene name
SETD2
Definition
(RefSeq) SET domain containing 2
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:nle00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100584442 (SETD2)
Enzymes [BR:nle01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100584442 (SETD2)
Chromosome and associated proteins [BR:nle03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100584442 (SETD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SRI SET WW
Motif
Other DBs
NCBI-GeneID: 100584442
NCBI-ProteinID: XP_012365733
LinkDB All DBs
Position
4
AA seq 2499 aa AA seqDB search
MFSWLNGNREEENEAKIENVQKTGFIKGPMFKGVASSRFLPKGTKTKVNLEEQGRQKVSF
SFSLTKKTLQNRFLTALGNEKQSDTPNPPAVPLQVDSTPKMKMEIGDTLPAAEESSPPKS
RVELGKIHFKKHLLHVTSRPLLATTTAVASPPTHAAPLPAVTAESTTVDSPPSSPPPPPP
PFQATTLSSPAPVTEPVALPHTPITVLMAAPVPLPVDVAVRSLKEPPIIIVPESLEAGTK
QDTVSNSSEEHIIQILNEQADISSKKEDSHIGKDEEIPDSSKINLSCKKTGSKKKSSQSE
GTFLGSESDEDSVRTSSSQKSHDLKFSASIEKERDFKKSSAPLKSEDLGKSSRSKTDRDD
KYFSYSKLERDTRYVSSRCRSERERRRSRSHSRSERGSRTNLSYSRSERSHYYDSDRRYH
RSSPYRERTRYSRPYADNRARESSDSEEEYKKTYSRRTSSHSSSYRDLRTSSYSKSDRDC
KTETSYLEMERRGKYSSKLERESKRTSENEAIKRCCSPPNELGFRRGSSYSKHDSSASRY
KSTLSKPIPKSDKFKNSFCCTELNEEMKQSHSFSLQTPCSKGSELRMINKNPEREKAGSP
APSNRLNDSPTLKKLDELPIFKSEFITHDSHDGIKELDSLSKVKNDQLRSFCPIELNING
SPGAESDLATFCTSKTDAVLMTSDDSVTGSELSPLVKACMLSSNGFQNVSRCKEKDLDDT
CMLHKKSESPFRETEPLVSPHQDKLMSLPVMTIDYSKTVVKEPVDTRVSCCKTKDSDIYC
TSNDSNPSLCNSEAENIEPSVMKISSNSFMNMHLESKPVICDSRNLTDHSKFACEEYKQS
IGSTSSASVNHFDDLYQPIGSSGIASSLQSLPPGIKVDSLTLLKCGENTSPVLDAVLKSK
KSSEFLKHAGKETIVEVGSDLPDSGKGFVSRENRRNNGLSGKCLQEAQEEGNSILPERRG
RPEISLDERGEGGRVHTSDDSEVVFSSCDLNLTVEDSDGVTYALRCDSSGHAPEIVSTVH
EDYSGSSESSNDESDSEDTDSDDSSIPRNRLQSVVVVPKNSTLPMEETSPCSSRSSQSYR
HYSDHWEDERLESRRHSYEEKFESIASKACPQTDKFFLHKGTEKNLEISFTQSSRKQIDN
HLPELSHPQSDGVDSTSHTDVKSDPLGHPNSEETVKAKISSRQQEELPIYSSDFEDVPNK
SWQQATFQNRPDSRLGKTELSFSSSCEISRVDVLHSSEELRNLGWDFSQEKPSTTYQQPD
SSYGACGGHKYQQNTEQYGGTRDYWQGNGYWDPRPGRPPGTGVVYDRTQGQVPDSLTDDR
EEEENWDQQDGSHFSDQSNKFLLSLQKDKGSVQAPEISSNSIKDTLAVNEKKDFSKNLEK
NDIKDRGPLKKRRQEIESDSESDGELQDRKKVRVEVEQGETSVPPGSALVGPSCVMDDFR
DPQRWKECAKQGKMPCYFDLIEENVYLTERKKNKSHRDIKRMQCECTPLSKDERAQGEIA
CGEDCLNRLLMIECSSRCPNGDYCSNRRFQRKQHADVEVILTEKKGWGLRAAKDLPSNTF
VLEYCGEVLDHKEFKARVKEYARNKNIHYYFMALKNDEIIDATQKGNCSRFMNHSCEPNC
ETQKWTVNGQLRVGFFTTKLVPSGSELTFDYQFQRYGKEAQKCFCGSANCRGYLGGENRV
SIRAAGGKMKKERSRKKDSVDGELEALMENGEGLSDKNQVLSLSRLMVRIETLEQKLTCL
ELIQNTHSQSCLKSFLERHGLSLLWIWMAELGDGRESNQKLQEEIIKTLEHLPIPTKNML
EESKVLPIIQRWSQTKTAVPPLSEGDGYSSENTSRAHTPLNTPDPFTKLSTEADTDTPKK
LMFRRLKIISENSMDSAISDATSELEGKDGKEDLDQLENVPVEEEEELQSQQLLPQQLPE
CKVDSETNVEASKLPTSDRSSDLATKLLDSWKDLKEVYRIPKKSQTEKENTTTERGRDAV
GFRDQTPAPKTPNRSRERDPDKQTQNKEKRKRRSSLSPPSSAYERGTKRPDDRYDTPTSK
KKVRIKDRNKLSTEERRKLFEQEVAQREAQKQQQQMQNLGMTSPLPYDSLGYNAPHHPFA
GYPPGYPMQAYVDPSNPNAGKVLLPTPSMDPVCSPAPYDHAQPLVGHSTEPLSAPPPVPV
VPHVAAPVEVSSSQYVAQSDGVVHQDSSVAVLPVPAPGPVQGQNYSVWDSNQQSVSVQQQ
YSPAQSQATIYYQGQTCPTVYGVTSPYSQTTPPIVQSYAQPSLQYIQGQQIFTAHPQGVV
VQPAAAVTTIVAPGQPQPLQPSEMVVTNNLLDLPPPSPPKPKTIVLPPNWKTARDPEGKI
YYYHVITRQTQWDPPTWESPGDDASLEHEAEMDLGTPTYDENPMKASKKPKTAEADTSSE
LAKKSKEVFRKEMSQFIVQCLNPYRKPDCKVGRITTTEDFKHLARKLTHGVMNKELKYCK
NPEDLECNENVKHKTKEYIKKYMQKFGAVYKPKEDTELE
NT seq 7500 nt NT seq  +upstreamnt  +downstreamnt
atgttttcttggctgaatggaaatagagaagaagaaaacgaggcaaagattgaaaatgtg
cagaaaacaggtttcatcaaaggaccaatgttcaaaggtgttgcttctagtcgatttttg
cccaaaggcaccaaaacaaaagttaatttggaagaacagggacgacagaaggtgtcattc
agcttcagccttacaaagaaaactttgcagaataggtttctcactgcacttggcaatgaa
aagcaaagtgatactccaaaccctccagctgtacctcttcaggtagactcgactcctaaa
atgaaaatggaaattggtgataccttacctgctgcagaagaatcttccccaccaaagtca
agggtggaattgggcaaaattcattttaagaaacacctgcttcatgtaacatccaggcca
ctgctggctactaccacagcagtagcatctccgcctactcatgcagcaccattaccagca
gtgacagcagaatcaacaactgtagactcaccgccctcatctccgcctccaccgcctcca
cctttccaagccacaacactctcatcaccagcaccagtaacagagccagtggccttgcca
catacaccaataacagttctaatggcagcaccagtacccttaccagtagatgtagcagtt
agatctctgaaagaaccaccaattataattgtaccagaatctttagaagcaggtactaag
caggacactgtatctaatagttcagaagaacacataattcaaatattgaatgagcaagca
gatatttcctcaaaaaaagaagattcccatattgggaaggatgaagaaattccagatagt
tctaagattaatctgagctgtaaaaaaacaggttctaagaagaaatcctcacaatctgaa
ggcacctttcttggttcagaatctgatgaagattctgtacggacttcttcaagtcaaaaa
tcacatgatttaaaattttcagcaagcattgaaaaggaaagagattttaaaaagagctca
gcacctttaaaaagtgaggatctagggaaatcttcacgatctaaaacagacagagatgat
aaatattttagctattcaaaacttgaaagagatactcggtatgtatcttcccgatgtaga
tcagaaagagagcgacggcggagcagatctcattctaggtctgagagaggctctagaact
aatttatcctattccaggtcagaacgatctcattattatgactctgatcgtcgctaccat
aggagctccccttatcgagagaggacacgctattctcggccatacgcagataacagagca
cgagagagttctgactcagaagaagagtataagaagacatactcaaggcgtacctcatct
cattcctcttcttacagagacctaaggacatcatcctattctaaatctgatcgggactgt
aaaactgagacctcttacttagagatggaaagaagaggcaagtattcttcaaaactagaa
agagaatctaaaaggacttcagaaaatgaagcaattaaaagatgttgttctccccctaat
gaactgggattccgacgagggtcatcatattctaagcacgacagtagtgcttcccgttat
aagtctaccctttcaaaacctatacccaagtctgataaatttaaaaattctttctgttgt
acagaattaaatgaagaaatgaaacagtctcattcttttagtttacagacaccttgttca
aaaggtagtgaattaagaatgattaataaaaatcctgaaagagaaaaggctgggtctcca
gctccatcaaatcgattaaatgattcacctactttaaaaaagctagatgagttgcctatt
tttaagtctgaatttataacacatgatagccatgatggtattaaggaattagactcttta
tctaaagtgaagaatgatcaattaagaagtttttgtcccatagaattaaatataaatgga
tctcctggggcagaatctgatttggcaacattttgcacttctaaaactgatgctgtttta
atgacttctgatgatagtgtgactggatcggagttatcccctttggtcaaagcatgcatg
ctttcgtcaaatggatttcagaatgttagtagatgcaaagaaaaagacttggatgataca
tgcatgctgcataagaagtcagaaagcccatttagagaaacagaacctctggtgtcacca
caccaagataaactcatgtctttgccagttatgactatagattattccaaaacagtagtt
aaagaaccagttgatacgagggtttcttgctgcaaaaccaaagattcagacatatactgt
acttcgaacgatagcaacccttctttgtgtaactccgaagctgaaaatattgagccttcg
gttatgaagatttcttcaaatagctttatgaatatgcatttggaatcaaaaccagttata
tgtgatagtagaaatttgacagatcactcaaaatttgcatgtgaagaatataagcagagc
atcggtagcactagttcagcttctgttaatcattttgatgatttatatcaacctattggg
agttccggtattgcttcatctcttcagagtcttccaccgggaataaaggtggacagtcta
actctcttgaaatgcggagagaacacatctccagttctggatgcagtgctaaagagtaaa
aaaagttcagagtttttaaagcatgcagggaaagaaacaatagtagaagtaggtagtgac
cttcctgattcaggaaaaggatttgtttccagggagaacaggcgtaataatgggttatct
gggaaatgtttgcaagaggctcaagaagaagggaattccatattgcctgaaagaagagga
agaccagaaatctctttagatgaaagaggagaaggaggacgtgtgcatacttctgatgac
tcagaagttgtattttcttcttgtgatttgaatttaaccgtggaagacagtgatggtgta
acttatgcattaaggtgtgacagtagtggtcatgccccagaaattgtgtctactgttcat
gaagattattctggctcttctgaaagttcaaatgatgaaagtgattcagaagatacagat
tcggatgatagcagtattccaagaaaccgtctccagtctgttgtggttgtgccaaagaat
tctactttgcccatggaagaaacaagtccttgttcttctcggagcagtcaaagttataga
cactattctgaccattgggaagacgagagattggagtcaaggagacattcttatgaggaa
aaatttgaaagtatagcaagtaaagcctgtcctcaaactgataagtttttccttcataaa
ggaacagagaagaatctggaaatttcttttacacagtccagtagaaaacaaatagataac
cacctgcctgaactttctcatcctcagagtgatggggttgatagtacaagtcatacagat
gtgaaatctgaccctctgggtcacccaaattcagaggaaaccgtgaaagccaaaatatct
tctaggcagcaagaagagctgccaatttattcttctgattttgaagatgtcccaaataag
tcttggcaacaggccactttccaaaacaggccagatagtagactgggaaaaacagaattg
agtttttcttcctcttgtgagatatcacgtgtggatgtcttgcactcatcagaagagctc
agaaacttaggttgggacttctctcaagaaaagccttctactacatatcaacaacctgac
agtagctatggagcttgtggtggacacaagtatcagcaaaatacagaacagtatggtggg
acacgtgattactggcaaggcaatggttactgggatccaagaccaggtagacctcctgga
actggggttgtgtatgatcgaactcaaggacaagtaccagattccctaacagatgatcgt
gaagaagaggagaattgggatcaacaggatggatcccatttttcagaccagtccaataaa
tttcttctatcccttcagaaagacaaggggtcagtgcaagcacccgaaataagtagcaat
tccattaaggacactttagctgtgaatgaaaagaaagatttttcaaaaaacttagaaaaa
aatgatatcaaagatagagggcctcttaagaaaaggaggcaggaaatagagagtgattct
gaaagtgatggtgagcttcaggacagaaagaaagttagagtggaggtagagcagggagag
acatcagtgcccccaggctcagcactggttgggccctcctgtgtcatggatgacttcagg
gacccacagcgatggaaggaatgtgccaagcaagggaaaatgccttgttactttgatctt
attgaagaaaatgtttatttaacagaaagaaagaagaataaatctcatcgagatattaag
cgaatgcagtgtgagtgtacacctctttctaaagatgaaagagctcaaggtgaaatagca
tgtggggaagattgtcttaatcgtcttctcatgattgaatgttcttctcggtgtccaaat
ggggattattgttccaatagacggtttcagagaaaacagcatgcagatgtggaagtcata
ctcacagaaaagaaaggctggggcttgagagctgccaaagaccttccttcgaacaccttt
gtcctagaatattgtggagaggtactcgatcataaagagtttaaagctcgagtgaaggag
tatgcacgaaacaaaaacatccattactatttcatggccctgaagaatgatgagataata
gatgccactcaaaaaggaaactgctctcgtttcatgaatcacagctgtgaaccaaactgt
gaaacccaaaaatggactgtgaacggacaactgagggttgggttttttaccaccaaactg
gttccttcaggctcagagttaacgtttgactatcagtttcagagatatggaaaagaagcc
cagaaatgtttctgcggatcagccaattgccggggttacctgggaggagaaaacagagtc
agcatcagagcagcaggagggaaaatgaagaaggaacgatctcgtaagaaggattcagtg
gatggagagctagaagctctgatggaaaatggtgagggtctttctgataaaaaccaggtg
ctcagcttatcccggctaatggttagaattgaaactttggagcagaaacttacctgtctg
gaactcatacagaacacacactcacaatcctgcctgaagtcatttctggaacgtcatggg
ctgtctttgttgtggatctggatggcagagctaggtgacggccgggaaagtaaccagaag
cttcaggaagagattataaagactttggaacacttgcccattcctactaaaaatatgttg
gaggaaagcaaagtacttccaattattcaacgctggtctcagactaagactgctgtccct
ccgttgagtgaaggagatgggtattctagtgagaatacatcgcgtgctcacacaccactc
aacacacctgatcctttcaccaagctgagcacagaggctgacacagacactcccaagaaa
ctaatgtttcgcagactgaaaattataagtgaaaatagcatggacagtgcaatctctgat
gcaaccagtgagctagaaggcaaggatggcaaagaggatcttgatcaattagaaaatgtc
cctgtagaggaagaggaagaattgcagtcacaacagctactcccacaacagctgcctgaa
tgcaaagttgatagtgaaaccaacgtagaagctagtaagctacctacatctgaccggagc
agtgatttggccaccaaactcctggacagttggaaagacctaaaggaggtatatcgaatt
ccaaagaaaagtcaaaccgaaaaggagaacacaacaactgaacgaggaagggatgctgtt
ggcttcagagatcaaacacctgccccgaagactcctaataggtcaagagagagagaccca
gacaagcaaactcaaaataaagagaaaaggaaacgaagaagctccctctcaccaccctct
tctgcctatgagcggggaacaaaaaggccagatgacagatatgatacaccaacttctaaa
aagaaagtacgaattaaagaccgcaataaactttctacagaggaacgccggaagttgttt
gagcaagaggtggctcaacgggaggctcagaaacaacagcaacagatgcagaacctggga
atgacatcaccactgccctatgactctcttggttataatgccccgcatcatccctttgct
ggttacccaccaggttatcccatgcaggcctatgtggatcccagcaaccctaatgctgga
aaggtgctcctgcccacacccagcatggacccagtgtgttctcctgctccttatgatcat
gctcagcccttggtgggacattctacagaacccctttctgcccctccaccagtaccagtg
gtgccacatgtggcagctcctgtggaagtttccagttcccagtatgtggcccagagtgat
ggtgtagtacaccaagactccagcgttgctgtcttgccagtgccagcccctggtccagtt
cagggacagaattatagtgtttgggattcaaaccaacagtctgtcagtgtacagcagcag
tactctcctgcacagtctcaagcaaccatatattatcaaggacagacatgtccaacagtc
tatggtgtgacatcaccttattcacagacaactccaccaattgtacagagttatgcccag
ccaagtcttcagtatatccaggggcaacagattttcacagctcatccacaaggagtggtg
gtacagccagccgcagcagtgactacaatagttgcaccagggcagcctcagcccttgcag
ccttctgaaatggttgtgacaaataatctcttagatctgccgcccccatctcctcccaaa
ccaaaaaccattgtcttacctcccaactggaagacagcccgagatccagaagggaagatt
tattattaccatgtgatcacaaggcagactcagtgggatcctcctacttgggaaagccca
ggagatgatgccagccttgagcatgaagctgagatggacctgggaactccaacatatgat
gaaaaccccatgaaggcctcaaaaaagcccaagacagcagaagcagacacctccagtgaa
ctagcaaagaaaagcaaagaagtattcagaaaagagatgtcccagttcatcgtccagtgc
ctgaacccttaccggaaacctgactgcaaagtgggaagaattaccacaactgaagacttt
aaacatctggctcgcaagctgactcacggtgttatgaataaggagctgaagtactgtaag
aatcctgaggacctggagtgcaatgagaatgtgaaacacaaaaccaaggagtacattaag
aagtacatgcagaagtttggggctgtttacaaacccaaagaggacactgaattagagtga

DBGET integrated database retrieval system