KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100584804Help
Entry
100584804         CDS       T03265                                 

Gene name
TGM1
Definition
(RefSeq) transglutaminase 1
  KO
K05619  transglutaminase 1 [EC:2.3.2.13]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Brite
KEGG Orthology (KO) [BR:nle00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    100584804 (TGM1)
Enzymes [BR:nle01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     100584804 (TGM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core
Motif
Other DBs
NCBI-GeneID: 100584804
NCBI-ProteinID: XP_003260733
UniProt: G1RZJ6
LinkDB All DBs
Position
22a
AA seq 808 aa AA seqDB search
MMDGPRSDVGRWGGNPLQPPTTPSPEPEPEPEPDRRSRRGGGGRSFWARCCGCCSCRNAV
DDDWGPEPSDSRGRGSSSGTRRPVSRGSGVNAAGDGTIREGMLVVNGVDLLSSRSDQNRR
QHHTEEYEYDELIVRRGQPFHMLLLLSRTYESSDRITLELLIGNNPEVGKGTHVIIPVGK
GGSGGWKAQVVKASGQNLNLRVHTSPNAIIGKFQFTVRTQSDAGEFQLPFDPRNEIYILF
NPWCPEDIVYVDHEDWRQEYVLNESGRIYYGTEAQIGERTWNYGQFDHGVLDACLYILDR
RGMPYGGRGDPVSVSRVISAMVNSLDDNGVLIGTGSGDYSRAPTHQRGGQREILLSYLRG
LFRPYGQCWVFAGVTTTVLRCLGLATRTVTNFNSAHDTDTSLTMDIYFDENMKPLEHLNH
DSVWNFHVWNDCWMKRPDLPSGFDGWQVVDATPQETSSGIFCCGPCSVESIKNGLVYMKY
DTPFIFAEVNSDKVYWQRQDDGSFKIVYVEEKAIGTLIVTKAIGSNMREDITYLYKHPEG
SDAERKAVETAAAHGSKPNVYANRGSAEDVAMQVEAQDAVMGQDLMVSVMLTNHSSSRRT
VKLHLYLSVTFYTGVSGTIFKETKKEVELAPGASDRVTMPVAYKEYRPHLVDQGAMLLNV
SGHVKESGQVLAKQHTFRLRTPDLSLTLLGAAVVGQECEVQIVFKNPLPVTLTNVVFRLE
GSGLQRPKILNVGDIGGNETVTLRQTFVPVRPGPRQLIASLDSPQLSQVHGVIQVDVAPA
PGDRGFFSDAGGDSHLGETIPMASRGGA
NT seq 2427 nt NT seq  +upstreamnt  +downstreamnt
atgatggatgggccacgttccgacgtgggccgttggggtggcaatcccttgcagccccct
accacgccgtctccagagccagagccggagccagagccagacagacgctctcgcagagga
gggggaggccgttccttctgggctcgctgctgtggctgctgttcatgccgaaatgcggtg
gatgacgactggggacctgaaccctctgactccaggggtcgagggtccagctctggcact
cgaagacctgtctcccggggcagtggtgtcaatgcagctggagatggcaccatccgagag
ggcatgctagtagtgaacggtgtggacttgctgagctcgcgctcagaccagaaccgccga
cagcaccacacggaggagtatgagtacgacgagctgatagtgcgccgcgggcagcctttc
cacatgctcctcctcctgtcccggacctatgaatcctctgatcgcatcacccttgagtta
ctcattggaaacaaccccgaggtgggcaagggcacgcacgtgatcatcccagtgggcaag
gggggcagtggaggctggaaagcccaggtggtcaaggccagtgggcagaatctgaacctg
agggtccatacttcccccaacgccatcatcggcaagtttcagtttacagtccgcacacaa
tcagacgctggggagttccagttgccctttgacccccgcaacgagatctacatcctcttc
aacccctggtgcccagaggacattgtgtacgtggaccatgaggattggcggcaggagtat
gtacttaatgagtctgggagaatttactatgggaccgaagcacagattggtgagcggacc
tggaactacggccagtttgaccacggggtgctggatgcctgcctatacattctggaccgg
cgagggatgccatatggcggccgtggagacccagtcagtgtctcccgggtcatctctgcc
atggtgaactccctggatgacaatggagtcctgattgggactggttctggtgattactcc
cgagcaccaacccatcagcgtggtgggcagcgtgagatcctgcttagctacctacgcggg
ctattccgtccctatggccagtgctgggtctttgctggcgtgaccactacagtgctgcgc
tgcctgggtctggccacccgtactgtcaccaacttcaactccgcccacgacacagacaca
tcccttaccatggacatctacttcgacgagaacatgaagcccctggagcacctgaaccat
gattctgtctggaacttccatgtgtggaacgactgctggatgaagaggccggatctgccc
tcgggctttgacgggtggcaggtggtggatgccacgccccaggagactagcagtggcatc
ttctgctgcggcccctgctccgtggagtccatcaagaatggcctggtctacatgaagtac
gacacgcctttcatttttgctgaggtgaatagtgacaaggtgtactggcagcggcaggac
gatggcagcttcaagattgtgtatgtggaggagaaggccatcggcacactcattgtcaca
aaggccatcggctccaacatgcgggaggacatcacctacctctataagcacccagaaggc
tcagacgcagagcggaaggcagtagagacagcagcagcccatggcagcaaacccaatgtg
tatgccaaccggggctcagcggaggatgtggccatgcaggtggaggcacaggacgcggtg
atggggcaggatctgatggtctctgtgatgctgaccaatcacagcagcagccgccgcaca
gtgaaactgcacctctacctctcagtcaccttctatactggtgtcagtgggaccatcttc
aaggagacgaagaaggaagtggagctggcaccaggggcctcggaccgtgtgaccatgcca
gtggcctacaaggaataccggccccatcttgtggaccagggggccatgctgctcaatgtc
tcaggccatgtcaaggagagcgggcaggtgctggccaagcagcacaccttccgtctgcgc
accccagacctctccctcacgttactgggagcagcagtggttggccaggagtgtgaagta
cagattgtcttcaagaacccccttcccgtcaccctcaccaatgtcgtcttccggctcgag
ggctctgggttacagaggcccaagatcctcaacgttggggacattggaggtaatgaaaca
gtgacactgcgccagacatttgtgcctgtgcgaccaggcccccgccagctcattgccagc
ttggacagcccgcagctctcccaggtgcacggtgtcatccaggtggatgtggccccagcc
cctggggacaggggcttcttctcagacgctggaggtgacagtcacttgggagagaccatc
cctatggcatctcgaggtggagcttag

DBGET integrated database retrieval system