KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100585174Help
Entry
100585174         CDS       T03265                                 

Gene name
SOD2
Definition
(RefSeq) superoxide dismutase 2
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04068  FoxO signaling pathway
nle04146  Peroxisome
nle04211  Longevity regulating pathway
nle04213  Longevity regulating pathway - multiple species
nle05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100585174 (SOD2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    100585174 (SOD2)
 09150 Organismal Systems
  09149 Aging
   04211 Longevity regulating pathway
    100585174 (SOD2)
   04213 Longevity regulating pathway - multiple species
    100585174 (SOD2)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05016 Huntington disease
    100585174 (SOD2)
Enzymes [BR:nle01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     100585174 (SOD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 100585174
NCBI-ProteinID: XP_003271807
UniProt: G1RJQ3
LinkDB All DBs
Position
3
AA seq 222 aa AA seqDB search
MLSRAVCGTSRQLAPALGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVN
NLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHTIFWTNLSPNGGGEPKGELLEA
IKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLL
GIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgttgagccgggcagtgtgcggcaccagcaggcagctggcgccggctttggggtatctg
ggctccaggcagaagcacagccttcccgacctgccctacgactacggcgccctggagcct
cacatcaacgcgcagatcatgcagctgcaccacagcaagcaccacgcggcctacgtgaac
aacctgaacgtcaccgaggagaagtaccaggaggcgttggccaagggagatgttacagcc
cagatagctcttcagcctgcactgaagtttaatggtggtggtcatatcaatcataccatt
ttctggacaaacctcagccctaatggtggtggagaacccaaaggggagttgctggaagcc
atcaaacgtgactttggttcctttgacaagtttaaggagaagctgacggctgcatctgtt
ggtgtgcaaggctcaggttggggttggcttggtttcaataaggaacggggacacttacaa
attgctgcttgtccgaatcaggatccactgcaaggaacaacaggccttattccactgctg
gggattgatgtgtgggagcacgcttactaccttcagtataaaaatgtcaggcctgattac
ctaaaagctatttggaatgtaatcaactgggagaatgtaaccgaaagatacatggcttgc
aaaaagtaa

DBGET integrated database retrieval system