KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100585467
Entry
100585467         CDS       T03265                                 

Gene name
APC
Definition
(RefSeq) adenomatous polyposis coli protein isoform X3
  KO
K02085  adenomatosis polyposis coli protein
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04310  Wnt signaling pathway
nle04390  Hippo signaling pathway
nle04550  Signaling pathways regulating pluripotency of stem cells
nle04810  Regulation of actin cytoskeleton
nle04934  Cushing syndrome
nle05010  Alzheimer disease
nle05022  Pathways of neurodegeneration - multiple diseases
nle05165  Human papillomavirus infection
nle05200  Pathways in cancer
nle05206  MicroRNAs in cancer
nle05210  Colorectal cancer
nle05213  Endometrial cancer
nle05217  Basal cell carcinoma
nle05224  Breast cancer
nle05225  Hepatocellular carcinoma
nle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100585467 (APC)
   04390 Hippo signaling pathway
    100585467 (APC)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100585467 (APC)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100585467 (APC)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100585467 (APC)
   05206 MicroRNAs in cancer
    100585467 (APC)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100585467 (APC)
   05225 Hepatocellular carcinoma
    100585467 (APC)
   05226 Gastric cancer
    100585467 (APC)
   05217 Basal cell carcinoma
    100585467 (APC)
   05213 Endometrial cancer
    100585467 (APC)
   05224 Breast cancer
    100585467 (APC)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100585467 (APC)
   05022 Pathways of neurodegeneration - multiple diseases
    100585467 (APC)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100585467 (APC)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100585467 (APC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:nle01009]
    100585467 (APC)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:nle03036]
    100585467 (APC)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:nle04812]
    100585467 (APC)
Protein phosphatases and associated proteins [BR:nle01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100585467 (APC)
Chromosome and associated proteins [BR:nle03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    100585467 (APC)
Cytoskeleton proteins [BR:nle04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    EB / APC
     100585467 (APC)
SSDB
Motif
Pfam: Arm_APC_u3 APC_basic EB1_binding APC_r APC_u5 APC_u14 APC_rep APC_u15 APC_u9 SAMP APC_N_CC Arm APC_u13 APC_15aa Suppressor_APC JIP_LZII
Other DBs
NCBI-GeneID: 100585467
NCBI-ProteinID: XP_004087472
Ensembl: ENSNLEG00000011525
UniProt: G1RLE9
LinkDB
Position
2
AA seq 2844 aa
MAAASYDQLLKQVEALKMENSNLRQELEDNSNHLTKLETEASNMKEVLKQLQGSIEDEAM
ASSGQIDLLERLKELNLDSSNFPGVKLRSKMSLRSYGSREGSVSSRSGECSPVPMGSFPR
RGFVNGSRESTGYLEELEKERSLLLADLDKEEKEKDWYYAQLQNLTKRIDSLPLTENFSL
QTDMTRRQLEYEARQIRVAMEEQLGTCQDMEKRAQRRIARIQQIEKDILRIRQLLQSQAT
EAERSSQSKHETGSHDAERQNEGQGVGEINMATSGNGQGSATRVDHETASVLSSSSTHSA
PRRLTSHLGTKVEMVYSLLSMLGTHDKDDMSRTLLAMSSSQDSCISMRQSGCLPLLIQLL
HGNDKDSVLLGNSRGSKEARARASAALHNIIHSQPDDKRGRREIRVLHLLEQIRAYCETC
WEWQEAHEQGMDQDKNPMPAPVEHQICPAVCVLMKLSFDEEHRHAMNELGGLQAIAELLQ
VDCEMYGLTNDHYSITLRRYAGMALTNLTFGDVANKATLCSMKGCMRALVAQLKSESEDL
QQVIASVLRNLSWRADVNSKKTLREVGSVKALMECALEVKKESTLKSVLSALWNLSAHCT
ENKADICAVDGALAFLVGTLTYRSQTNTLAIIESGGGILRNVSSLIATNEDHRQILRENN
CLQTLLQHLKSHSLTIVSNACGTLWNLSARNPKDQEALWDMGAVSMLKNLIHSKHKMIAM
GSAAALRNLMANRPTKYKDANIMSPGSSVPSLHVRKQKALEAELDAQHLSETFDNIDNLS
PKASHRSKQRHKQSLYGDFVFDTNRHDDNRSDNFNAGNMTVLSPYLNTTVLPSSSSSRGS
LDSSRSEKDRSLERERGIGLGNYHPATENPGTSSKRGLQLSTTAAQIAKVMEEVSAIHTS
QEDRSSGSTTELHCVTDERNALRRSSAAHTHSSTYNFSKSENSNRTCSMPYAKLEYKRSS
NDSLNSVSSSDGYGKRGQMKPSIESYSEDDESKFCSYGQYPADLAHKIHSANHMDDNDGE
LDTPINYSLKYSDEQLNSGRQSPSQNERWARPKHIIEDELKQSEQRQSRNQSTTYPVYTE
STDDKHLKFQPHFGQQECVSPYRSRGANGSETNRVGSNHGINQNVSQSLCQEDDYEDDKP
TNYSERYSEEEQHEEEERPTNYSIKYNEEKHHVDQPIDYSLKYATDIPSSQKQSFSFSKS
SSGQSTKTEHMSSSSENTSTPSSNAKRQNQLHPSSAQSRSGQTQKAATCKVSSINQETIQ
TYCVEDTPICFSRCSSLSSLSSAEDEIGCDQRTQEADSANTLQVVEIKEKIGTRSTEDPV
SEVPAVSQHTRTKSSRLQCSSLSSESARHKAVEFSSGAKSPSKSGAQTPKSPPEHYVQET
PLMFSRCTSVSSLDSFESRSIASSVQSEPCSGMVSGIISPSDLPDSPGQTMPPSRSKTPP
PPPQTAQTKREVPKNKAPTAEKRESGPKQAAVNAAVQRVQVLPDADTLLHFATESTPDGF
SCSSSLSALSLDEPFIQKDVELRIMPPVQENDNGNETESEQPKESNENQEKEAEKTIDSE
KDLLDDSDDDDIEILEECIISAMPTKSSRKAKKPAQTASKLPPPVARKPSQLPVYKLLPS
QNRLQPQKHVSFTPGDDMPRVYCVEGTPINFSTATSLSDLTIESPPNELAAGEGVRGGAQ
SGEFEKRDTIPTEGRSTDEAQGGKTSSVTIPELDDNKTEEGDILAECINSAMPKGKSHKP
FRVKKIMDQVQQASASSSAPNKNQLDGKKKKPTSPVKPIPQNTEYRTRVRKNADSKNNLN
AERVFSDNKDSKKQNLKNNSKDFNDKLPNNEDRVRGSFAFDSPHHYTPIEGTPYCFSRND
SLSSLDFDDDDVDLSREKAELRKAKENKESEAKVTSHTELTSNQQSANKTQAIAKQPINR
GQPKPILQKQSTFPQSSKDIPDRGAATDEKLQNFAIENTPVCFSHNSSLSSLSDIDQENN
NNKENEPIKETEPTDSQGEPSKPQASGYAPKSFHVEDTPVCFSRNSSLSSLSIDSEDDLL
QECISSAMPKKKKPSRLKGDNEKHSPRNMGGILAEDLTLDLKDIQRPDSEHGLSPDSENF
DWKAIQEGANSIVSSLHQAAAAACLSRQASSDSDSILSLKSGISLGSPFHLTPDQEEKPF
TSNKGPRILKPGEKSTLETKKIESESKGIKGGKKVYKSLITGKVRSNSEISGQMKQPLQA
NMPSISRGRTMIHIPGVRNSSSSTSPVSKKGPPLKTPASKSPSEGQTATTSPRGAKPSVK
SELSPVARQTSQIGGSSKAPSRSGSRDSTPSRPAQQPLSRPIQSPGRNSISPGRNGISPP
NKLSQLPRTSSPSTASTKSSGSGKMSYTSPGRQMSQQNLTKQTGLSKNASSIPRSESASK
GLNQMNNGNGANKKVELSRMSSTKSSGSESDRSERPVLVRQSTFIKEAPSPTLRRKLEES
ASFESLSPSSRPASPSRSQAQTPVLSPSLPDMSLSTHSSVQAGGWRKLPPNLSPTIEYND
GRPAKRHDIARSHSESPSRLPINRSGTWKREHSKHSSSLPRVSTWRRTGSSSSILSASSE
SSEKAKSEDEKHVNSISGTKQSKENQVSAKGTWRKIKENEISPTNSTSQTVSSGATNGAE
SKTLIYQMAPAVSKTEDVWVRIEDCPINNPRSGRSPTGNTPPVIDSVSEKGNPNIKDSKD
NQAKQNVGNGSVPMRTVGLENRLNSFIQVDAPDQKGTETKPGQNNPVPVSEANESSIVER
TPFSSSSSSKHSSPSGTVAARVTPFNYNPSPRKSSADSTSARPSQIPTPVNNNTKKRDSK
TDSTESNGTQSPKRHSGSYLVTSV
NT seq 8535 nt   +upstreamnt  +downstreamnt
atggctgcagcttcatatgatcagttgttaaagcaagttgaggcactgaagatggagaac
tcaaatcttcgacaagagctagaagataattccaatcatcttacaaaactggaaactgag
gcatctaatatgaaggaagtacttaaacaactacaaggaagtattgaagatgaagctatg
gcttcctctggacagattgatttattagagcgtcttaaagagcttaacttagatagcagt
aatttccctggagtaaaactacggtcaaaaatgtccctccgttcttatggaagccgggaa
ggatctgtatcaagccgttctggagagtgcagtcctgttcctatgggttcctttccaaga
agagggtttgtaaatggaagcagagaaagtactggatatttagaagaacttgagaaagag
aggtcattgcttcttgctgatcttgacaaagaagaaaaagaaaaagactggtattatgct
caacttcagaatctcactaaaagaatagatagtcttcctttaactgaaaatttttcctta
caaacagatatgaccagaaggcaattggagtatgaagcgaggcaaatcagagttgcaatg
gaagaacaactaggtacctgccaggatatggaaaaacgagcacagcgaagaatagccaga
attcagcaaatcgaaaaggacatacttcgtatacgacagcttttacagtcccaagcaaca
gaagcagagaggtcatctcagagcaagcatgaaaccggctcacatgatgctgagcggcag
aatgaaggtcaaggagtgggagaaatcaacatggcaacttctggtaatggtcagggttca
gctacacgagtggaccacgaaacagccagtgttttgagttctagtagcacacactctgca
cctcgaaggctgacaagtcatctgggaaccaaggtggaaatggtgtattcattgttgtca
atgcttggtactcatgataaggatgatatgtcgcgaactttgctagctatgtctagctcc
caagacagctgtatatccatgcgacagtctggatgtcttcctctcctcatccagctttta
catggcaatgacaaagactctgtattgttgggaaattcccggggcagtaaagaggctcgg
gccagggccagtgcagcactccacaacatcattcactcacagcctgatgacaagagaggc
aggcgtgaaatccgagtccttcatcttttggaacagatacgcgcttactgtgaaacctgt
tgggagtggcaggaagctcatgaacaaggcatggaccaggacaaaaatccaatgccagct
cctgttgaacatcagatctgtcctgctgtgtgtgttctaatgaaactttcatttgatgaa
gagcatagacatgcaatgaatgaactagggggactacaggccattgcagaattattgcaa
gtggactgtgaaatgtatgggcttactaatgaccactacagtattacactaagacgatat
gctggaatggctttgacaaacttgactttcggagatgtagccaacaaggctacgctatgc
tctatgaaaggctgcatgagagcacttgtggcccaactaaaatctgaaagtgaagactta
cagcaggttattgcaagtgttttgaggaatttgtcttggcgagcagatgtaaatagtaag
aagacgttgcgggaagttggaagtgtgaaagcattgatggaatgtgctttagaagttaaa
aaggaatcaaccctcaaaagcgtattgagtgccttatggaatttgtcagcacattgcact
gagaataaagctgatatatgtgctgtagatggtgcacttgcatttttggttggcactctt
acttaccggagccagacaaacactttagccattattgaaagtggaggtgggatattacgg
aatgtgtccagcttgatagctacaaatgaggaccacaggcaaatcctaagagagaacaac
tgtctacaaactttattacaacacttaaaatctcatagtttgacaatagtcagtaatgca
tgtggaactttgtggaatctctcagcaagaaatcctaaagaccaggaagcattatgggac
atgggggcagttagcatgctcaagaacctcattcattcaaagcacaaaatgattgctatg
ggaagtgctgcagctttaaggaatctcatggcaaataggcctacgaagtacaaggatgcc
aatattatgtctcctggctcaagcgtgccatctcttcatgttaggaaacaaaaagcccta
gaagcagaattagatgctcagcatttatcagaaacttttgacaatatagacaatttaagt
cccaaggcatctcatcgtagtaagcaaagacacaagcaaagtctctatggtgattttgtt
tttgacaccaatcgacatgatgataataggtcagacaattttaatgctggcaacatgact
gtcctttcaccatatttgaatactacagtgttacccagctcctcttcgtcaagaggaagc
ttagatagttctcgttctgaaaaagatagaagtttggagagagaacgaggaattggtcta
ggcaactaccatccagcaacagaaaatccaggaacctcttcaaagcgaggtttgcagctc
tccaccactgcagcccagattgccaaagtcatggaagaagtgtcagccattcatacctct
caggaagacagaagttctgggtctaccactgaattacattgtgtgacagatgagagaaat
gcacttagaagaagctctgctgcccatacacattcaagcacttacaatttcagtaagtca
gaaaattcaaataggacatgttctatgccttatgccaaattagaatacaagagatcttca
aatgatagtttaaatagtgtcagtagtagtgatggttatggtaaaagaggtcaaatgaaa
ccctcaattgaatcctattctgaagatgatgaaagtaagttttgcagttatggtcaatac
ccagccgacctagcccataaaatacatagtgcaaatcatatggatgataatgatggagaa
ctagatacaccaataaattatagtcttaaatattcagatgagcagttgaactctggaagg
caaagtccttcacagaatgaaagatgggcaagacccaaacacataatagaagatgaacta
aaacaaagtgagcaaagacaatcaaggaatcaaagtacaacttaccctgtttatactgag
agcactgatgataaacacctcaagttccaaccacattttggacagcaggaatgtgtttct
ccatacagatcacggggagccaatggttcagaaacaaatcgagtgggttctaatcatgga
attaatcaaaatgtaagccagtctttgtgtcaagaagatgactatgaagatgataagcct
accaactatagtgaacgttactctgaagaagaacagcatgaagaagaagagagaccaaca
aattatagcataaaatataatgaagagaaacaccatgtggatcagcctattgattatagt
ttaaaatatgccacagatattccttcgtcacagaaacagtcattttcattctcaaagagt
tcatctggacaaagcactaaaactgaacatatgtcttcaagcagtgagaatacgtccaca
ccttcatctaatgccaagaggcagaatcagctccatccaagttctgcacagagtagaagt
ggtcagactcaaaaggctgccacttgcaaagtttcttctattaaccaagaaacaatacag
acttattgtgtagaagatactccaatatgtttttcaagatgtagttcactgtcatctttg
tcatcagctgaagatgaaataggatgtgatcagaggacacaggaagcagattctgctaac
accctgcaagtagtagaaataaaagaaaagattggaactagatcaactgaagatcctgtg
agcgaagttccagcagtgtcgcagcacactagaaccaaatccagcagactgcagtgttct
agtttatcttcagaatcagccaggcacaaagctgttgaattttcttcaggagcaaaatct
ccctccaaaagtggtgctcagacacccaaaagtccacctgaacactatgttcaggagact
ccactcatgtttagcagatgtacttctgtcagttcacttgatagttttgagagtcgttcg
attgccagctctgttcagagtgaaccgtgcagtggaatggtaagtggcattataagcccc
agtgatcttccagatagccctggacaaaccatgccaccaagcagaagtaaaacccctcca
ccacctcctcaaacagctcaaaccaagcgagaagtacctaaaaataaagcacctactgct
gaaaagagagagagtggacctaagcaagctgcagtaaatgctgcagttcagagggtccag
gttcttccagatgctgatactttattacattttgccacggaaagtactccagatggattt
tcttgttcatccagcctgagtgctctgagcctcgatgagccatttatacagaaagatgtg
gaattaagaataatgcctccagttcaggaaaatgacaatggaaatgaaacagaatcagag
cagcctaaagaatcaaatgaaaaccaagagaaagaggcagaaaaaactattgattctgaa
aaggacctattagatgattcagatgatgatgatattgaaatactagaagaatgtattatt
tctgccatgccaacaaagtcatcacgtaaagcaaaaaagccagcccagactgcttcaaaa
ttacctccacctgtggcaaggaaaccaagtcagctgcctgtgtacaaacttctaccatca
caaaacaggttgcaaccccaaaagcatgttagttttacaccgggagatgatatgccacgg
gtgtattgtgtagaagggacacctataaacttttccacagctacatctctaagtgatcta
acaatagaatcccctccaaatgagttagctgctggagaaggagttagaggaggggcacag
tcaggtgaatttgaaaaacgagataccattcctacagaaggcagaagtacagatgaagct
caaggaggaaaaacctcgtctgtaaccatacctgaattggatgacaataaaacagaggaa
ggtgatattcttgcagaatgcattaattctgctatgcccaaagggaaaagtcacaagcct
ttccgtgtgaaaaagataatggaccaggtccagcaagcatctgcgtcttcctctgcaccc
aacaaaaatcagttagatggtaagaaaaagaaaccaacttcaccagtaaaacctatacca
caaaatactgaatataggacacgtgtaagaaaaaatgcagactcgaaaaataatttaaat
gccgagagagttttctcagacaacaaagattcaaagaaacagaatttgaaaaataattcc
aaggacttcaatgataagctgccaaataatgaagatagagtcagaggaagttttgctttt
gattcacctcatcattacacacctattgaaggaactccttactgtttttcacgaaatgat
tctttgagttctctagattttgatgatgatgatgttgacctttccagggaaaaggctgag
ttaagaaaggcaaaagaaaataaggaatcagaagctaaagttaccagccacacggaacta
acctccaaccaacaatcagctaataagacacaagctattgcaaagcagccaataaatcga
ggtcagcctaaacccatacttcagaaacaatccacttttccccagtcatccaaagacata
ccagacagaggggcagcaactgatgaaaagttacagaattttgctattgaaaatactcca
gtttgcttttctcataattcctctctgagttctctcagtgacattgaccaagaaaacaac
aacaataaagaaaatgaacctatcaaagagactgagcccactgactcacagggagaacca
agtaaacctcaagcatcaggctatgctcctaaatcgtttcatgttgaagataccccagtt
tgtttctcaagaaacagttctctcagttctcttagtattgactctgaagatgacctgttg
caggaatgtataagctctgcaatgccaaaaaagaaaaagccttcaagactcaagggtgat
aatgaaaaacatagtcccagaaatatgggtggcatattagctgaagatctgacacttgat
ttgaaagatatacagagaccagattcagaacatggtctatcccctgattcagaaaatttt
gattggaaagctattcaggaaggtgcaaattccatagtaagtagtttacatcaagctgct
gctgctgcatgtttatctagacaagcttcgtctgattcagattccatcctttccctgaaa
tcaggaatctctctgggatcaccatttcatcttacacctgatcaagaagaaaaacccttt
acaagtaataaaggcccacgaattctaaaaccaggagagaaaagtacattggaaactaaa
aagatagaatctgaaagtaaaggaatcaaaggaggaaaaaaagtttataaaagtttgatt
actggaaaagttcgatctaattcagaaatttcaggccaaatgaaacagccccttcaagca
aacatgccttcaatctctcgaggcaggacaatgattcatattccaggagttcgaaatagc
tcctcaagtacaagtcctgtttctaaaaaaggcccaccccttaagactccagcctccaaa
agccctagtgaaggtcaaacggccaccacttctcctagaggagccaagccatctgtgaaa
tcagaattaagccctgttgccaggcagacatcccaaataggtgggtcaagtaaagcacct
tctagatcaggatctagagattcaaccccttcaagacctgcccagcaaccattaagtaga
cctatacagtctcctggccgaaactcaatttcccctggtagaaatggaataagtcctcct
aacaaattatctcaacttccaaggacatcatcccctagtactgcttcaactaagtcctca
ggttctggaaaaatgtcatatacatctccaggtagacagatgagccaacagaaccttacc
aaacaaacaggtttatccaagaatgccagtagtattccaagaagtgagtctgcctccaaa
ggactaaatcagatgaataatggtaatggagccaataaaaaggtagaactttctagaatg
tcttcaactaaatcaagtggaagtgaatctgatcgatcagaaagacctgtattagtacgc
cagtcaactttcatcaaagaagctccaagcccaaccttaagaagaaaattggaggaatct
gcttcatttgaatctctttctccatcatctagaccagcttctcccagtaggtcccaggca
caaactccagttttaagtccttcccttcctgatatgtctctatctacacattcatctgtt
caggctggtggatggcgaaaactcccacctaatctcagtcccactatagagtataatgat
ggaagaccagcaaagcgccatgatattgcacggtctcattctgaaagtccttctagactt
ccaatcaataggtcaggaacctggaaacgtgagcacagcaaacattcatcatcccttcct
cgagtaagcacttggagaagaactggaagttcatcttcaattctttctgcttcatcagaa
tccagtgaaaaagcaaaaagtgaggatgaaaaacatgtgaactctatttcaggaaccaaa
caaagtaaagaaaaccaagtatccgcaaagggaacatggagaaaaataaaagaaaatgaa
atttctcccacaaatagtacttctcagaccgtttcctcaggtgctacaaatggtgctgaa
tcaaagactctaatttatcaaatggcacctgctgtttctaaaacagaggatgtttgggtg
agaattgaggactgtcccattaacaatcctagatctggaagatctcccacaggtaatact
ccccctgtgattgacagtgtttcagaaaagggaaatccaaacattaaagattcaaaagat
aatcaggcaaaacaaaatgtgggtaatggcagtgttcccatgcgtaccgtgggtttggaa
aatcgcctgaactcctttattcaggtagatgcccctgaccaaaaaggaactgagacaaaa
ccaggacaaaataatcctgtccctgtatcagaggctaatgaaagttctatagtggaacgt
accccattcagttctagcagctcaagcaaacacagttcacctagtgggactgttgctgcc
agagtgactccttttaattacaacccaagccctaggaaaagcagcgcagatagcacttca
gctcggccatctcaaatcccaactccagtgaataacaacacaaagaagcgagattccaaa
actgacagcacagaatccaatggaacccaaagtcctaagcgccattctgggtcttacctt
gtgacatccgtttaa

KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100602025
Entry
100602025         CDS       T03265                                 

Gene name
APC2
Definition
(RefSeq) adenomatous polyposis coli protein 2 isoform X1
  KO
K02085  adenomatosis polyposis coli protein
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04310  Wnt signaling pathway
nle04390  Hippo signaling pathway
nle04550  Signaling pathways regulating pluripotency of stem cells
nle04810  Regulation of actin cytoskeleton
nle04934  Cushing syndrome
nle05010  Alzheimer disease
nle05022  Pathways of neurodegeneration - multiple diseases
nle05165  Human papillomavirus infection
nle05200  Pathways in cancer
nle05206  MicroRNAs in cancer
nle05210  Colorectal cancer
nle05213  Endometrial cancer
nle05217  Basal cell carcinoma
nle05224  Breast cancer
nle05225  Hepatocellular carcinoma
nle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100602025 (APC2)
   04390 Hippo signaling pathway
    100602025 (APC2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100602025 (APC2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100602025 (APC2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100602025 (APC2)
   05206 MicroRNAs in cancer
    100602025 (APC2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100602025 (APC2)
   05225 Hepatocellular carcinoma
    100602025 (APC2)
   05226 Gastric cancer
    100602025 (APC2)
   05217 Basal cell carcinoma
    100602025 (APC2)
   05213 Endometrial cancer
    100602025 (APC2)
   05224 Breast cancer
    100602025 (APC2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100602025 (APC2)
   05022 Pathways of neurodegeneration - multiple diseases
    100602025 (APC2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100602025 (APC2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100602025 (APC2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:nle01009]
    100602025 (APC2)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:nle03036]
    100602025 (APC2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:nle04812]
    100602025 (APC2)
Protein phosphatases and associated proteins [BR:nle01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100602025 (APC2)
Chromosome and associated proteins [BR:nle03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    100602025 (APC2)
Cytoskeleton proteins [BR:nle04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    EB / APC
     100602025 (APC2)
SSDB
Motif
Pfam: APC_basic APC_rep APC_N_CC APC_r Arm_APC_u3 Arm Suppressor_APC SAMP bZIP_1 HALZ APG6_N
Other DBs
NCBI-GeneID: 100602025
NCBI-ProteinID: XP_030652239
Ensembl: ENSNLEG00000001665
LinkDB
Position
17
AA seq 2401 aa
MAPARLPVPSLAVSPASLIPHPPPLAVVSPSARSSGAACPGRDRALSAPEPLPAPRRPRS
PRAPRPPRAGISGGARGAAQREEAPDPGAPPAQLQTLQELKMASSVAPYEQLVRQVEALK
AENSHLRQELRDNSSHLSKLETETSGMKEVLKHLQGKLEQEARVLVSSGQTEVLEQLKAL
QMDITSLYNLKFQAPTLGPEPAARTPEGSPVHGSGPSKDSFGELSRATIRLLEELDRERC
FLLNEIEKEEKEKLWYYSQLQGLSKRLDELPHVETQFSMQMELIRQQLEFEAQHIRSLME
ERFGTSDEMVQRAQIRASRLEQIDKELLEAQDRVQQTEPQALLAVKSVPVDEDPETEVPT
HPEDGTPQPGNSKVEVVFWLLSMLATRDQEDTARTLLAMSSSPESCVAMRRSGCLPLLLQ
ILHGTEVAAGGRAGAPGAPGAKDARMRANAALHNIVFSQPDQGLARKEMRVLHVLEQIRA
YCETCWDWLQARDGGPEGGGNGSAPIPIEPQICQATCAVMKLSFDEEYRRAMNELGGLQA
VAELLQVDYEMHKMTRDPLNLALRRYAGMTLTNLTFGDVANKATLCARRGCMEAIVAQLA
SDSEELHQVVSSILRNLSWRADINSKKVLREAGSVTALVQCVLRATKESTLKSVLSALWN
LSAHSTENKAAICQVDGALGFLVSTLTYKCQSNSLAIIESGGGILRNVSSLIATREDYRQ
VLRDHNCLQTLLQHLTSHSLTIVSNACGTLWNLSARSARDQELLWDLGAVGMLRNLVHSK
HKMIAMGSAAALRNLLAHRPAKHQAAATAVSPGSCVPSLYVRKQRALEAELDARHLAQAL
EHLEKQGPPASEAATKKPLPPLRHLDGLAQDYASDSGCFDDDDAPSSLAAAAATGEPASP
AALSLFLGSPFLQGQALARTPPTRRGGKEAEKDSSGEAAVAAKAKAKLALAVARIDQLVE
DISALHTSSDDSFSLSSGDPGQEAPREGRAQSCSPCRGPEGGRREAGSRAHPLLRLKAAQ
ASLSNDSLNSGSASDGYCPREHMLPCPLAALASRREDPRCGQPRPSRLDLDLPGSQAEPP
AREATSADARVRTIKLSPTYQHVPLLEGASRAGAEPLAGPGTSPGARKQAWLPADHLSKV
PEKLVAAPLSVASKALQKLVAQEGPLSLSRCSSLSSLSSAGRPGPSEGGDLDDSDSSLEG
LEEAGPGEAELDSAWRAPGATSLPVAIPAPRRNRGRGLGVEDATPSSSSENYVQETPLVL
SRCSSVSSLGSFESPSIASSIPSDPCSGQGSGTISPSELPDSPGQTMPPSRSKTPPLAPA
PQGAPEASQFSLQWESYVKRFLDIADCRERCRLPSELDAGSVRFTVEKPDENFSCASSLS
ALALHEHYVQQDVELRLLPSACPERGGGAGLHFAGHRRREEGPAPTGSRPRGAADQELEL
LRECLGAAVPARLRKVASALMPGRRALPVPVYMLVPAPAPAPAQEDDSCTDSAEGTPVNF
SSAASLSDETLQGPPRDQPEGPAGRQRPTGRPTSARQAVGHRHKAGGAGRSAEQSQGAGK
NRAGLELPLGRPPSAPADKDGSKPGRTRGDGALQSLCLTTPTEEAVYCFYGNDSDEEPPA
AAPTPTHRRTSAIPRAFRRERPQGRKEAPAPSKAAPAAPPPARTQPSLIADETPPCYSLS
SSASSLSEPEPSEPPAVHPRGREPAVTKDPGPGGGRDSSPSPRAAEELLQRCISSALPRR
RPPVSSLRRRKPRATRLDERPAEGSRERGEEAAGSDRASDLDSVEWRAIQEGANSIVTWL
HQAAAATREASSESDSILSFVSGLSVGSTLQPPKHRKGRQAEGEIGSARRPEKRGAASAK
TSGSPRSPAGPEKPRGTQKTTPGVPAVLRGRTVIYVPSPAPRAQPKGTPGPRATPRKVAP
PCLAQPAAPAKVPSPGQQRSRSLHRPGKTTELATLSQPPRSATPPARLAKTPSSSSSQTS
PASQPLPRKRPPVTQAAGPLPGPGASPVPKTPARTLLAKQHKTQRSPVRIPFMQRPARRG
PPPLARAVPEQGPRGRAGTEAGPGARGGRLGLVRVASALSSGSESSDRSGFRRQLTFIKE
SPGLRRRRSELSSAASAASAPQGASPRRGRPALPAVFLCSSRCEELRAAPRQAPARQRPP
AARPGPGERPARRTSSESPSRLPVRAPVARPETVKRYASLPHISVARRPDGAVPAAPAPA
DAGRRSSDGEPRPLPRVAAPGTTWRRIRDEDVPHILRSTLPATALPLRGSTPEDAPAGPP
PRKTSDAVVQTEEVAAPKTNSSTSPSLESREPPGAPAGGQLSLLGSDVDGPSLAKAPISA
PFVHEGLGVAVGGFPASRHGSPSRSARVPPFNYVPSPMVVAVTTDSAAEKAPATASATLL
E
NT seq 7206 nt   +upstreamnt  +downstreamnt
atggcaccagcccgtcttcccgtgccttcattggctgtctcacccgcatccctcatcccg
catcctcccccgctcgcggtggtctcgcccagcgctaggagcagcggcgccgcctgccca
ggccgggaccgggctttgtccgccccggagcccctgcccgcgccgcggagaccccggagc
ccgcgtgctccgaggccaccccgggccgggatttccggtggggcccgcggagctgcgcag
agggaggaggccccagacccgggcgccccgccagcccagctgcaaacgctgcaggagctg
aagatggcgagctccgtggcgccctacgagcagctggtgcggcaggtggaggccttgaag
gctgagaacagccacctgaggcaggagctaagggacaactccagccacctgtccaagctg
gagacagagacgtcgggcatgaaggaggtcctgaagcacctacagggaaaactggagcag
gaggcccgagtgctggtgtcctcggggcagacggaggtgctggagcagctgaaggcccta
cagatggacattaccagcctgtacaacctcaagttccaggcgcccaccctgggcccggag
cctgccgcccgcacccccgagggcagcccagtacacggctccgggccctccaaggacagc
tttggggagctgagccgggccaccatccggctgctggaggaactggaccgggaacggtgt
ttccttctgaatgagattgagaaggaggagaaggagaagctctggtactactcgcagctg
cagggcctgtccaagcgcctggacgagctgccgcacgtggagacgcagttctcgatgcag
atggagctgatccggcagcagcttgagttcgaggcccagcacatccgctcgctgatggag
gagcgcttcggcacctcggacgagatggtgcagcgggcacagatccgcgcctcgcgcctg
gagcagattgacaaggagctgctggaggcgcaggaccgagtgcagcagacggagccccag
gccttgctggcggtgaagtcggtgccggtggacgaggaccccgagacagaggtccccaca
caccctgaggatggcacccctcagccgggcaacagcaaggtggaggtggtcttctggctg
ttgtccatgttggcgacgcgcgaccaggaggatacagcgcgcacgctgctggccatgtcc
agctcgcctgagagctgcgtggccatgcgccgctcgggctgtctgccgctgctgctgcaa
atcctccacggcaccgaggtcgcggccgggggccgcgccggggccccaggagcaccgggc
gccaaggacgcacgcatgcgcgccaacgcggcgctgcacaacatcgtcttctcgcagccg
gaccagggcctggctcgcaaggagatgcgcgtcctgcacgtgctggagcagatccgggcc
tactgcgagacctgctgggactggctgcaggcccgagacggcgggcccgagggaggcggc
aacggcagcgccccgatccccatcgagccgcagatctgccaggccacctgtgctgttatg
aagctgtcctttgacgaggagtaccgccgtgccatgaacgagctaggtgggctgcaggcc
gtggcagagctgctgcaggttgactacgagatgcacaagatgacccgggacccgctgaac
ctggcgcttcgccgctacgcgggcatgaccctcaccaacctcacctttggggacgttgcc
aacaaggccaccctgtgtgcacgccgcggctgcatggaggccatcgtggcccagctggcc
tccgacagtgaggagcttcaccaggtggtgtccagcatccttcggaacttgtcctggaga
gccgacatcaacagcaagaaggtgctgagggaggcgggcagcgtgactgccctggtgcag
tgtgtcctgcgggccaccaaggagtccaccctgaagagcgtgctgagcgccctgtggaat
ctgtctgcacacagcacagagaacaaggcggccatctgccaggtggatggcgccctgggc
ttcctggtgagcaccctgacctacaagtgccagagcaactcgctggccatcatcgagagc
ggcggcggcatcctccgcaacgtgtccagcctcatcgccacccgtgaggactacaggcag
gtgctccgggatcacaactgtctgcagacgctgctgcagcacctgacttcgcacagcctg
accatcgtgagcaacgcgtgcggcacgctctggaacctgtctgcccgcagcgcccgggac
caggagctgctgtgggacctgggcgctgtgggcatgctgcgtaatctggtgcactccaaa
cacaagatgatcgccatgggcagcgccgccgccctgcgcaacctgctggcccatcggccc
gccaagcaccaggcggctgccaccgccgtgtccccaggcagctgcgtgcccagcctatac
gtgcgcaagcagcgggcgctggaggccgagctggacgcacggcacctcgcgcaagcactg
gagcacctggagaagcagggcccgccggcgtccgaggccgccactaagaagccgctgccg
cccctgcgacacctggatggcctggcccaagactatgcttccgattcgggctgctttgac
gacgacgatgcaccgtcatccctggctgcggccgcggccaccggggagccagccagccct
gccgcgctgtccctcttcctgggcagccccttcctgcaggggcaggcgctggctcgcacc
ccgcccacccgccgaggcggcaaggaggcggagaaggacagcagtggggaggcagccgtg
gcggccaaggccaaggccaagctggcgcttgcagtggcgcgcatcgaccagctggtggag
gacatctccgccctgcacacctcgtctgacgatagtttcagcctcagctctggagacccg
gggcaggaggcgccacgggagggccgcgcccagtcctgctcgccatgccgcggcccagag
ggcgggcggcgagaggcaggaagtcgggcgcacccgctgctgcggctcaaggcggcccaa
gccagcctctccaacgacagcctcaacagcggcagtgccagcgacgggtactgcccacgc
gaacatatgctgccctgcccgctggccgcactggcttcgcgccgcgaggaccccaggtgt
gggcagcctcggcccagccggcttgaccttgacctgccaggcagccaggccgagccccca
gctcgcgaggccacatccgccgacgcccgcgtgcgcaccatcaagctgtcgcctacctat
cagcacgtgccactgctcgagggtgcctcaagggcgggtgcagagcccctcgcggggcct
ggaacctctccaggggcccggaagcaggcctggctgccggcagaccacctgagcaaggtt
cccgagaagctggtggctgccccgctgtccgtggccagcaaggcgctgcagaaactggtg
gcgcaagaggggccgctctcgctatcccgatgcagctccctttcctcgctgtcctcggcc
ggccgcccaggccccagcgagggcggtgacctggatgacagtgactcctccctggagggg
ctggaggaggccggccccggcgaggctgagctggacagcgcatggcgggcgcccggggcc
acctcgctgcccgtagccattccggctccccggcgtaaccgaggccggggcctgggggtg
gaggacgccacgccctccagctcgtcggagaactacgtgcaggagacgccgctcgtgctg
agccgctgcagctctgtgagctcgctgggcagcttcgagagcccgtccattgccagctcc
atccccagtgacccttgcagcgggcagggcagcggcaccatcagccctagcgagctgccc
gacagccccgggcagaccatgcctcccagccggagcaagacgccgccgctggcgcccgcg
ccacagggtgcccccgaggccagccagttcagcctgcagtgggagagctacgtgaagcgc
tttctggacatcgccgactgccgggagcgctgccggctgccatctgagctggatgcaggc
agcgtgcgctttaccgtggagaagccagatgagaacttctcgtgcgcctccagcctcagc
gcgctggccttgcacgagcactacgtgcagcaggacgtggagctgcggctgctgccctcg
gcctgcccggagcgcggcgggggcgccggcctccactttgcagggcaccggcggcgggag
gaggggccggctcccacgggttctcgcccccgcggcgccgcggaccaggagctggaactg
ctgcgggagtgcctgggagccgccgtgcctgcccggctccgcaaagtggcctcggcgctg
atgccaggtcgccgcgcactccccgtgcccgtctacatgttggtgcccgccccggccccg
gccccagcccaggaggatgactcctgcactgactccgcggagggcacgccggtcaacttc
tccagcgccgcctcgctcagcgacgagacgctgcagggaccccccagggaccagcccgag
ggaccagcgggcaggcaaagacccaccggccgccccacctctgccaggcaggccgtgggg
caccggcacaaggcgggaggcgccggccgcagcgcggagcagtctcagggcgcgggcaag
aaccgagcagggctggagctgcccttgggccggcccccgagcgcccccgcagacaaggac
ggctcaaagcccggccggacccgcggggacggggcgctccagtcgctgtgcctcacgacg
cccaccgaggaggccgtgtactgcttctacggcaacgactcggacgaggagccccctgcg
gccgcgcccacgcccacccaccggcgcacatcggccatcccccgcgcttttaggcgggag
cgcccgcagggccggaaggaggcccctgccccgtccaaggccgcaccagccgcccccccg
cccgcccggacccagcccagcctcattgctgacgagaccccgccctgctactccctgagc
tcctccgccagctccctcagcgagcccgagccctcggagccgccggccgtccatccacga
ggccgggagcccgcggtcaccaaggacccgggcccaggaggcggacgcgacagctcaccc
agcccgcgggccgcggaggagcttctgcagcggtgcatcagctcggccctgcccaggcgc
cggccccctgtgtctagcctgcggcgccgcaagccccgagccaccaggctagatgagcgg
cccgcggaggggtcccgggaacgcggcgaggaggcagcgggctcggaccgggcctccgac
ctggacagcgtggagtggcgcgccatccaggagggcgccaattcaatcgtcacgtggctg
caccaggcagcagctgccacgcgagaggcctcgtctgagtccgactccatcctatccttc
gtatccgggctgtcggtggggtccaccctacagccccccaagcacaggaagggacgacag
gcggagggcgaaattggcagtgcccggcggccagagaaaaggggcgcagcgtcagccaag
accagcgggagcccccgttcccctgcaggccccgagaagccacgtggcacacagaagacg
acgcccggggtgccagctgtgctccggggacgaacagtgatctacgtgcccagtccggca
ccccgtgcccagcccaaagggacccccggcccccgcgccacaccgcggaaggtggcgccc
ccttgcctggcacagcccgcggctccagccaaagtccccagccccggacagcagcggtcg
cggagcctacaccggcctggcaaaaccacggagctggcgacgctgagccagccccccaga
agcgccacaccgcccgcccgcctcgccaagaccccctcctccagctcctcccagacctcg
cccgcctcccagcccctgcccagaaagcgccccccggtcacccaggctgcagggcccctg
cccggccccggggcctccccagtgcccaagacgccggcgcgcacccttctggcgaagcag
cacaagacgcagaggtcgcccgtgcggatcccgttcatgcagaggccggcccggcgtggg
ccgccaccgctagctcgggcagtcccggagcagggccccaggggccgggcggggaccgag
gcgggcccgggggcgcgcgggggccgcctgggcctggtgcgcgtggcctcagccctctcc
agcggcagcgagtcctccgaccgctcgggcttccggcgacagctgaccttcatcaaggag
tcgccgggcttgcggcggcgccgctccgagctgtcctcggcggcgtccgcggcctctgcc
ccccagggcgcctcgccccgccgcggccggcccgcgctgcccgccgtcttcctctgctcc
tcgcgctgcgaagagctccgagcggcaccccggcaggccccggcccggcagcggccccca
gcggcccgacccggccctggcgagcgccctgcccggcgcaccagctccgagagcccgtcc
cgcctgcctgtgcgcgcgcctgtcgcccggccggagactgtcaagcgctacgcgtcgctg
ccgcacatcagcgtggcccgcaggcccgacggcgccgtccccgcggcccctgccccagcc
gacgccgggcgccgcagcagcgacggggagccccggccgctccccagggtggccgcgccg
ggcacgacgtggcggcgcatccgagatgaggacgtgccccacatcctgcgcagcacgctg
cccgccacggccctgccactgcggggctccacgcccgaggacgccccggccgggcccccg
ccgcgcaagaccagcgacgccgtggtccagaccgaggaggtcgctgcccccaagaccaac
tccagcacgtccccaagcctggagagcagggagccccccggggcccccgccggcggccag
ctctccctcctcggcagcgacgtggacggtcccagcctcgccaaggctcccatctccgca
cccttcgtgcacgagggcctgggggtcgccgtggggggcttccccgccagccggcacggc
tcccccagccgctcggcccgagtaccccccttcaactatgtgcccagccccatggtggtc
gcagtcaccaccgactcggccgcggagaaagccccggccactgcctccgccaccctcctg
gaatag

DBGET integrated database retrieval system