KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100585701
Entry
100585701         CDS       T03265                                 

Gene name
SMO
Definition
(RefSeq) smoothened homolog isoform X1
  KO
K06226  smoothened
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04340  Hedgehog signaling pathway
nle04360  Axon guidance
nle05200  Pathways in cancer
nle05205  Proteoglycans in cancer
nle05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    100585701 (SMO)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100585701 (SMO)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100585701 (SMO)
   05205 Proteoglycans in cancer
    100585701 (SMO)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    100585701 (SMO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:nle04030]
    100585701 (SMO)
G protein-coupled receptors [BR:nle04030]
 Frizzled / Smoothened family
  100585701 (SMO)
SSDB
Motif
Pfam: Frizzled Fz Dicty_CAR
Other DBs
NCBI-GeneID: 100585701
NCBI-ProteinID: XP_030682336
Ensembl: ENSNLEG00000012575
LinkDB
Position
13
AA seq 789 aa
MAAARPARGPELPLLGLLLLLLLLLGGPGRGAASSGNATGPGPRSAGGSARRSAAVTGPP
PPLSHCGRAAPCEPLRYNVCLGSVLPYGATSTLLAGDSDSQEEAHGKLVLWSGLRNAPRC
WAVIQPLLCAVYMPKCENDRVELPSRTLCQATRGPCAIVERERGWPDFLRCTPDRFPEGC
TNEVQNIKFNSSGQCEVPLVRTDNPKSWYEDVEGCGIQCQNPLFTEAEHQDMHSYIAAFG
AVTGLCTLFTLATFVADWRNSNRYPAVILFYVNACFFVGSIGWLAQFMDGARREIVCRAD
GTMRLGEPTSNETLSCVIIFVIVYYALMAGVVWFVVLTYAWHTSFKALGTTYQPLSGKTS
YFHLLTWSLPFVLTVAILAVAQVDGDSVSGICFVGYKNYRYRAGFVLAPIGLVLIVGGYF
LIRGVMTLFSIKSNHPGLLSEKAASKINETMLRLGIFGFLAFGFVLITFSCHFYDFFNQA
EWERSFRDYVLCQANVTIGLPTKQPIPDCEIKNRPSLLVEKINLFAMFGTGIAMSTWVWT
KATLLIWRRTWCRLTGQSDDEPKRIKKSKMIAKAFSKRHELLQNPGQELSFSMHTVSHDG
PVAGLAFDLNEPSADVSSAWAQHVTKMVARRGAILPQDISVTPVATPVPPEEQANLWLVE
AEISPELQKRLGRKKKRRKRKKEVCPLVPPPELHPPAPVPSTILRLPQLPRQKCLVAAGA
WGAGDSCQQGAWTLVSNPFCPEPSPPQDPFLPSAPAPMAWAHGCRQGLGPIHSRTNLMDA
ELMDADSDF
NT seq 2370 nt   +upstreamnt  +downstreamnt
atggccgctgcccgccccgcgcgggggccggagctcccgctcctggggctgctgctgctg
ctgctgctgctgctggggggcccgggccggggggcggcctcgagcgggaacgcgaccggg
cctgggcctcggagcgcgggcgggagcgcgaggaggagtgcggcggtgaccggccctccg
ccgccgctgagccactgcggccgggctgccccctgcgagccgctgcgctacaacgtttgc
ctgggctcggtactgccctacggggccacctccacactgctggcgggagactcggactcc
caggaggaagcgcacggcaagctcgtgctctggtcgggcctccggaatgccccccgctgc
tgggcagtgatccagcccctgctgtgtgccgtatatatgcccaagtgtgagaatgaccgg
gtggagctgcccagccgcaccctctgccaggccacccgaggcccgtgtgccatcgtggag
agggagcggggctggcctgacttcctgcgctgcactcctgaccgcttccctgaaggctgc
acgaatgaggtgcagaacatcaagttcaacagttcaggccagtgcgaagtgcccttggtt
cggacagacaaccccaagagctggtacgaggacgtggagggctgcggcatccagtgccag
aacccgctcttcaccgaggctgagcaccaggacatgcacagctacatcgcggcctttggg
gccgtcacgggcctctgcacgctcttcaccctggccacattcgtggctgactggcggaac
tcgaatcgctaccctgctgttattctcttctacgtcaatgcgtgcttctttgtgggcagc
attggctggctggcccagttcatggatggtgcccgccgggagatcgtctgccgtgcagat
ggcaccatgaggcttggggagcccacctccaatgagactctgtcctgtgtcatcatcttt
gtcatcgtgtactacgccctgatggccggtgtggtttggtttgtggtcctcacctatgcc
tggcacacttccttcaaagccctgggcaccacctaccagcctctctcgggcaagacctcc
tacttccacctgctcacctggtctctcccctttgtcctcactgtggcaatccttgctgtg
gcgcaggtggatggggactctgtgagtggcatttgttttgtgggctacaagaactaccga
tatcgtgcgggcttcgtgctggccccaatcggcctggtgctcatcgtgggaggctacttc
ctcatccgaggagtcatgactctgttctccatcaagagcaaccaccccgggctgctgagt
gagaaggctgccagcaagatcaacgagaccatgctgcgcctgggcatttttggcttcctg
gcctttggctttgtgctcattaccttcagctgccacttctacgacttcttcaaccaggct
gagtgggagcgcagcttccgggactatgtgctgtgtcaggccaatgtgaccatcgggctg
cccaccaagcagcccatccctgactgtgagatcaagaatcgcccgagccttctggtggag
aagatcaacctgtttgccatgtttggaactggcatcgccatgagcacctgggtctggacc
aaggccacactgctcatctggaggcgtacctggtgcaggttgactgggcagagtgacgat
gagccaaagcggatcaagaagagcaagatgattgccaaggccttctccaagcggcacgag
ctcctgcagaacccaggccaggagctgtccttcagcatgcacactgtgtcccacgacggg
cccgtggcgggcttggcctttgacctcaatgagccctcagctgatgtctcctctgcctgg
gcccagcatgtcaccaagatggtggctcggagaggagccatactgccccaggatatttct
gtcacccctgtggcaactccagtgcccccagaggaacaagccaacctgtggctggttgag
gcagagatctccccagagctgcagaagcgcctgggccggaagaagaagaggaggaagagg
aagaaggaggtgtgcccgctggtgccaccccctgagcttcatccccctgcccctgtcccc
agtaccattcttcgactgcctcagctgccccggcagaaatgcctggtggctgcaggtgcc
tggggagctggggactcttgccaacagggagcgtggaccctggtctccaacccattctgc
ccagagcccagtccccctcaggatccatttctgcccagtgcaccggcccccatggcatgg
gctcatggctgccgacagggcctggggcccattcactcccgcaccaacctgatggacgca
gaactcatggatgcagactcggacttctga

DBGET integrated database retrieval system