KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100586277
Entry
100586277         CDS       T03265                                 

Gene name
BMP4
Definition
(RefSeq) bone morphogenetic protein 4 isoform X1
  KO
K04662  bone morphogenetic protein 4
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04060  Cytokine-cytokine receptor interaction
nle04350  TGF-beta signaling pathway
nle04390  Hippo signaling pathway
nle04550  Signaling pathways regulating pluripotency of stem cells
nle04919  Thyroid hormone signaling pathway
nle05200  Pathways in cancer
nle05217  Basal cell carcinoma
nle05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    100586277 (BMP4)
   04390 Hippo signaling pathway
    100586277 (BMP4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100586277 (BMP4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100586277 (BMP4)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100586277 (BMP4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100586277 (BMP4)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    100586277 (BMP4)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100586277 (BMP4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:nle04052]
    100586277 (BMP4)
   00536 Glycosaminoglycan binding proteins [BR:nle00536]
    100586277 (BMP4)
Cytokines and growth factors [BR:nle04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   100586277 (BMP4)
Glycosaminoglycan binding proteins [BR:nle00536]
 Heparan sulfate / Heparin
  Morphogens
   100586277 (BMP4)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 100586277
NCBI-ProteinID: XP_003267752
Ensembl: ENSNLEG00000012666
UniProt: G1RQ54
LinkDB
Position
1a
AA seq 408 aa
MIPGNRMLMVVLLCQVLLGGASHASLIPETGKKKVAEIQGHAGGRRSGQSHELLRDFEAT
LLQMFGLRRRPQPSKSAVIPDYMRDLYRLQSGEEEEEQIHSTGLEYPERPASRANTVRSF
HHEEHLENIPGTSENSAFRFLFNLSSIPENEVISSAELRLFREQVDQGPDWEQGFHRINI
YEVMKPPAEAVPEHLITRLLDTRLVHHNVTRWETFDVSPAVLRWTGEKQPNYGLAIEVTH
LHQTRTHQGQHVRISRSLPQGSGNWAQLRPLLVTFGHDGRGHALTRRRRAKRSPKHHPQR
ARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTL
VNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR
NT seq 1227 nt   +upstreamnt  +downstreamnt
atgattcctggtaaccgaatgctgatggtcgttttattatgccaagtcctgctaggaggc
gcgagccatgctagtttgatacctgagacggggaagaaaaaagtcgccgagattcagggc
cacgcgggaggacgccgctcagggcagagccatgagctcctgcgggacttcgaggcgaca
cttctgcagatgtttgggctgcgccgccgcccgcagcctagcaagagtgcagtcattccg
gattacatgcgggatctttaccggcttcagtctggggaggaggaggaagagcagatccac
agcactggtctggagtatcctgagcgcccggccagccgggccaacaccgtgaggagcttc
caccacgaagaacatctggagaacatcccagggaccagtgaaaactctgcttttcgtttc
ctctttaacctcagcagcatccctgagaacgaggtgatctcctctgcagagcttcggctc
ttccgggagcaggtggaccagggccctgattgggaacagggcttccaccgtataaacatt
tatgaggttatgaagcccccagcagaagcggtgcctgagcacctcatcacacgactactg
gacacgagactggtccaccacaatgtgacacggtgggaaacttttgatgtgagccctgcg
gtccttcgctggaccggggagaagcagccaaactatgggctagccattgaggtgactcac
ctccatcagactcggacccaccagggccagcatgtcaggattagccgatcgttacctcaa
gggagtgggaattgggcccagctccggcccctcctggtcacctttggccatgatggccgg
ggccatgccttgacccgacgccggagggccaagcgtagccctaagcatcacccacagcgg
gcccggaagaagaataagaactgccggcgccactcgctctatgtggacttcagcgatgtg
ggctggaatgactggattgtggccccaccaggctaccaggccttctactgccatggggac
tgcccctttccactggctgaccacctcaactcaaccaaccatgccattgtgcagaccctg
gtcaattctgtcaattccagtatccccaaagcctgttgtgtgcccactgaactgagtgcc
atctccatgctgtacctggatgagtatgataaggtggtactgaaaaattatcaggagatg
gtagtagagggatgtgggtgccgctga

KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100586297
Entry
100586297         CDS       T03265                                 

Gene name
BMP2
Definition
(RefSeq) bone morphogenetic protein 2
  KO
K21283  bone morphogenetic protein 2
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04060  Cytokine-cytokine receptor interaction
nle04350  TGF-beta signaling pathway
nle04390  Hippo signaling pathway
nle05200  Pathways in cancer
nle05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    100586297 (BMP2)
   04390 Hippo signaling pathway
    100586297 (BMP2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100586297 (BMP2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100586297 (BMP2)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    100586297 (BMP2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:nle04052]
    100586297 (BMP2)
   00536 Glycosaminoglycan binding proteins [BR:nle00536]
    100586297 (BMP2)
Cytokines and growth factors [BR:nle04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   100586297 (BMP2)
Glycosaminoglycan binding proteins [BR:nle00536]
 Heparan sulfate / Heparin
  Morphogens
   100586297 (BMP2)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 100586297
NCBI-ProteinID: XP_003252536
Ensembl: ENSNLEG00000014079
UniProt: G1RV31
LinkDB
Position
11
AA seq 396 aa
MVAGTRCLLALLLPQVLLGGAAGLVPELGRRKFAASSSGRPSSQPSDEVLSEFELRLLSM
FGLKQRPTPSRDAVVPPYMLELYRRHSGQPGSPAPDHRLERAASRANTVRSFHHEESLEE
LPETSGKTTRRFFFNLSSIPTEEFITSAELQVFREQMQDALGNNSSFHHRINIYEIIKPA
TANSKFPVTRLLDTRLVNQNASRWESFDVTPAVMRWTAQGHANHGFVVEVTHLEEKQGVS
KRHVRISRSLHQDEHSWSQIRPLLVTFGHDGKGHPLHKREKRQAKHKQRKRLKSSCKRHP
LYVDFSDVGWNDWIVAPPGYHAFYCHGECPFPLADHLNSTNHAIVQTLVNSVNSKIPKAC
CVPTELSAISMLYLDENEKVVLKNYQDMVVEGCGCR
NT seq 1191 nt   +upstreamnt  +downstreamnt
atggtggccgggacccgctgtcttctagcgttgctgcttccccaggtcctcctgggcggc
gcggctggcctcgttccggagctgggccgcaggaagttcgcggcgtcgtcgtcgggccgc
ccctcatcccagccctctgacgaggtcctgagcgagttcgagttgcggctgctcagcatg
ttcggcctgaaacagagacccacccccagcagggacgccgtggtgcccccctacatgctg
gagctgtatcgcaggcactcgggtcagccgggctcacccgccccggaccaccggttggag
agggcggccagccgagccaacactgtgcgcagcttccaccatgaagaatctttggaagaa
ctaccagaaacgagtgggaaaacaacccggagattcttctttaatttaagttctatcccc
acggaggagtttatcacctcagcagagcttcaggtttttcgagaacagatgcaagatgct
ttaggaaacaatagcagtttccatcaccgaattaatatttatgaaatcataaaacctgca
acagccaactcgaaattccccgtgaccagacttttggacaccaggttggtgaatcagaat
gcaagcaggtgggaaagttttgatgtcacccccgctgtgatgcggtggactgcacaggga
cacgccaaccatggattcgtggtggaagtgacccacttggaggagaaacaaggtgtctcc
aagagacatgttaggataagcaggtctttgcaccaagatgaacacagctggtcacagata
aggccattgctagtaacttttggccatgatggaaaagggcatcctctccacaaaagagaa
aaacgtcaagccaaacacaaacagcggaaacgccttaagtccagctgtaagagacaccct
ttgtacgtggacttcagtgacgtggggtggaatgactggattgtggctcccccagggtat
cacgccttttactgccacggagaatgcccttttcctctggctgatcatctgaactccact
aatcatgccattgttcagacgttggtcaactctgttaactctaagattcctaaggcgtgc
tgtgtcccgacggaactcagtgctatctcgatgctgtaccttgacgaaaatgaaaaggtt
gtattaaagaactatcaggacatggttgtggagggttgtgggtgtcgctag

DBGET integrated database retrieval system