KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100587031Help
Entry
100587031         CDS       T03265                                 

Gene name
HDAC8
Definition
(RefSeq) histone deacetylase 8
  KO
K11405  histone deacetylase 8 [EC:3.5.1.98]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle05034  Alcoholism
nle05165  Human papillomavirus infection
nle05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:nle00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100587031 (HDAC8)
  Substance dependence
   05034 Alcoholism
    100587031 (HDAC8)
  Infectious diseases
   05165 Human papillomavirus infection
    100587031 (HDAC8)
Enzymes [BR:nle01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100587031 (HDAC8)
Chromosome and associated proteins [BR:nle03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     100587031 (HDAC8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 100587031
NCBI-ProteinID: XP_012354579
LinkDB All DBs
Position
X
AA seq 338 aa AA seqDB search
MVHSLIEAYALHKQMRIVKPKVASMEEMATFHTDAYLQHLQKVSQEGDDDHPDSIEYGLG
YDCPATEGIFDYAAAVGGATITAAQCLIDGMCKVAINWSGGWHHAKKDEASGFCYLNDAV
LGILRLRRKFERILYVDLDLHHGDGVEDAFSFTSKVMTVSLHKFSPGFFPGTGDVSDVGL
GKGRYYSVNVPIQDGIQDEKYYQICESVLKEVYQAFNPKAVVLQLGADTIAGDPMCSFNM
TPVGIGKCLKYILQWQLATLILGGGGYNLANTARCWTYLTGVILGKTLSSEIPDHEFFTA
YGPDYVLEITPSCRPDRNEPHRIQQILNYIKGNLKHVV
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggtacattctttgattgaagcgtatgcactgcataagcaaatgaggatagttaagcct
aaagtggcctccatggaggagatggccaccttccatactgatgcttatctgcagcatctc
cagaaggtcagccaagagggcgatgatgatcatccggactccatagaatatgggctaggt
tatgactgcccagccactgaagggatatttgactatgcagcagctgtaggaggggctacg
atcacagctgcccaatgcctgatcgacggaatgtgcaaagtagcaattaactggtctgga
gggtggcatcatgcaaagaaagatgaagcatctggtttttgttatctcaatgatgctgtc
ctgggaatattacgattgcgacggaaatttgagcgtattctctacgtggatttggatctg
caccatggagatggtgtagaagacgccttcagtttcacctccaaagtcatgaccgtgtcc
ctgcacaaattctccccaggatttttcccaggaacaggtgacgtgtctgatgttggccta
gggaagggacggtactacagtgtaaatgtgcccattcaggatggcatacaagatgaaaaa
tattaccagatctgtgaaagtgtactaaaggaagtataccaagcctttaatcccaaagca
gtggtcttacagctaggagctgacacaatagctggggatcccatgtgctcctttaacatg
actccagtgggaattggcaagtgtcttaaatacatccttcaatggcagttggcaacactc
attttgggaggaggaggctataaccttgccaacacggctcgatgctggacatacttgacc
ggggtcatcctagggaaaacactatcctctgagatcccagatcatgagtttttcacagca
tatggtcctgattatgtgctggaaatcacgccaagctgccggccagaccgcaatgagccc
caccgaatccaacaaatcctcaactacatcaaagggaatctgaagcatgtggtctag

DBGET integrated database retrieval system