KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100587810
Entry
100587810         CDS       T03265                                 

Gene name
KITLG
Definition
(RefSeq) kit ligand
  KO
K05461  KIT ligand
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04010  MAPK signaling pathway
nle04014  Ras signaling pathway
nle04015  Rap1 signaling pathway
nle04072  Phospholipase D signaling pathway
nle04151  PI3K-Akt signaling pathway
nle04640  Hematopoietic cell lineage
nle04916  Melanogenesis
nle05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100587810 (KITLG)
   04014 Ras signaling pathway
    100587810 (KITLG)
   04015 Rap1 signaling pathway
    100587810 (KITLG)
   04072 Phospholipase D signaling pathway
    100587810 (KITLG)
   04151 PI3K-Akt signaling pathway
    100587810 (KITLG)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100587810 (KITLG)
  09152 Endocrine system
   04916 Melanogenesis
    100587810 (KITLG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100587810 (KITLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:nle04052]
    100587810 (KITLG)
Cytokines and growth factors [BR:nle04052]
 Growth factors
  Growth factors (RTK binding)
   100587810 (KITLG)
SSDB
Motif
Pfam: SCF Psg1
Other DBs
NCBI-GeneID: 100587810
NCBI-ProteinID: XP_003259673
Ensembl: ENSNLEG00000005483
UniProt: G1R0E6
LinkDB
Position
10
AA seq 273 aa
MKKTQTWILTCIYLQLLLFNPLVKTEGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPG
MDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSS
KDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVT
KPFMLPPVAASSLRNDSSSSNRKAKNPPGDSSLHWAAMALPALFSLIIGFAFGALYWKKR
QPSLTRAVENIQINEEDNEISMLQEKEREFQEV
NT seq 822 nt   +upstreamnt  +downstreamnt
atgaagaagacacaaacttggattctcacttgcatttatcttcagctgctcctatttaat
cctctcgtcaaaaccgaagggatctgcaggaatcgtgtgactaataatgtaaaagacgtc
actaaattggtggcaaatcttccgaaagactatatgataaccctcaaatatgtccccggg
atggatgttttgccaagtcattgttggataagcgagatggtagtacaattgtcagacagc
ttgactgatcttctggacaagttttcaaatatttctgaaggtttgagtaattattccatc
atagacaaacttgtgaatatagtggatgaccttgtggagtgcgtgaaagaaaactcatct
aaggatctaaaaaaatcattcaagagcccagaacccaggctgtttactcctgaagaattc
tttagaatttttaatagatccatcgatgccttcaaggactttgtagtggcatctgaaact
agtgattgcgtggtttcttcaacattaagtcctgagaaagattccagagtcagtgtcaca
aaaccatttatgttaccccctgttgcagccagctcccttaggaatgacagcagtagcagt
aataggaaggccaaaaatccccctggagactccagcctacactgggcagccatggcattg
ccagcgttgttttctcttataattggctttgcttttggagccttatactggaagaagaga
cagccaagtcttacaagggcagttgaaaatatacaaattaatgaagaggataatgagata
agtatgttgcaagagaaagagagagagtttcaagaagtgtaa

DBGET integrated database retrieval system