KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100587965
Entry
100587965         CDS       T03265                                 

Gene name
KIF7
Definition
(RefSeq) kinesin-like protein KIF7 isoform X1
  KO
K18806  kinesin family member 7
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04340  Hedgehog signaling pathway
nle05200  Pathways in cancer
nle05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    100587965 (KIF7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100587965 (KIF7)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    100587965 (KIF7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:nle04812]
    100587965 (KIF7)
Cytoskeleton proteins [BR:nle04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     100587965 (KIF7)
SSDB
Motif
Pfam: Kinesin Microtub_bd
Other DBs
NCBI-GeneID: 100587965
NCBI-ProteinID: XP_030670860
Ensembl: ENSNLEG00000011722
LinkDB
Position
6
AA seq 1341 aa
MGLEAQRLPGAEEAPVRVALRVRPLLPKELLHGHQSCLQVEPGLGRVTLGRDRHFGFHVV
LAEDAGQEAVYQACVQPLLEAFFEGFNATVFAYGQTGSGKTYTMGEASVASLLEDEQGIV
PRAMAEAFKLIDENDLLDCLVHVSYLEVYKEEFRDLLEVGTASRDIQLREDERGNVVLCG
VKEVDVEGLDEVLSLLEMGNAARHTGATHLNHLSSRSHTVFTVTLEQRGRAPSRLPRPAP
GQLLVSKFHFVDLAGSERVLKTGSTGERLKESIQINSSLLALGNVISALGDPQRRGSHIP
YRDSKITRILKDSLGGNAKTVMIACVSPSSSDFDETLNTLNYASRAQNIRNRATINWRPE
AERPPEEAASGARGPPRHRSETRIIHRGRGAPGPATASAAAAMRLGAECARYRACTDAAY
SLLRELQAEPGLPGAAARKVRDWLCAVEGERSALSSASGPDSGIESASVEDQAAQGAGGR
KEDEGAQQLLTLQNQVARLEEENRDFLAALEDAMEQYKLQSDRLREQQEEMVELRLRLEL
VRPGWGGPGFLNGLPPGSFVPRPHTAPLGGAHAHVLSMVPPACLPGDEVGSEQRGEQVTN
GREAGAELLTEVNRLGSGSSAASEEEEEEELPRRTLHLRRNGISNCSQRVGARPGSLPER
KGPELCLEELDAAVPGSRAVGGSKARVQARQVPSATASERRLAQAQQKIRELAINIRMKE
ELIGELVRTGKAAQALNRQHSQRIRELEQEAERVRAELSEGQRQLRELEGKEPQDAGERS
RLQEFRRRVAAAQSQVQVLKEKKQATERLVSLSAQSEKRLQELERNVQLMRQQQGQLQRR
LREETEQKRRLEAEMSKRQHRVKELELKHEQQQKILKIKTEEIAAFQRKRRSGSNGSVVS
LEQQQKIEEQKKWLDQEMEKVLQQRRALEELGEELHKREAILAKKEALMQEKTGLESKRL
RSSQALNEDIVRVSSRLEHLEKELSEKSGQLRQGSAQSQQQIRREIDSLRQEKDSLLKQR
LEIDSKLRQGSLLSPEEERTLFQLDEAIEALDAAIEYKNEAITCRQRVLRASASLLSQCE
MNLMAKLSYLSSSETRALLCKYFDKVVTLREEQHQQQIAFSELEMQLEEQQRLVYWLEVA
LERQRLEMDRQLTLQQKEHEQNMQLLLQQSRDHLGEGLADSRRQYEARIQALEKELGRYM
WINQELKQKLGGVNAVGHSRGGEKRSLCSEGRQAPGNEDELQPAPELLWLSPLTEGAPRT
REERDLVHAPLPLTWKRSSMCGEEQGSPGELRQREAAEPLVGRVLPVGEAGLPWNFGPLS
KPRRELRRASPGMIDVRKNPL
NT seq 4026 nt   +upstreamnt  +downstreamnt
atggggctggaggctcagaggctgccaggggctgaggaggccccagtgcgggttgccctg
cgagttcgaccactgctgcccaaggagctgctgcacgggcatcagagctgcctgcaggtg
gagccagggcttggccgtgtcaccctgggccgtgaccgacattttggcttccacgtggtg
ctggccgaggatgccgggcaggaggccgtgtaccaggcctgcgttcagcccctccttgag
gccttcttcgagggcttcaatgccactgtctttgcctatggtcagacgggctcagggaag
acgtacaccatgggggaggccagtgtggcctccctccttgaggatgagcagggcattgtc
ccgagggccatggccgaggccttcaagctcatcgatgagaacgacctgcttgactgtctg
gtacatgtgtcttacctggaagtgtacaaggaggagttccgagacctgctcgaggtgggc
actgccagccgtgacattcagctccgggaagatgagcgcgggaatgttgtgctgtgcggg
gtgaaggaggtggacgtggagggcctggatgaggtgctgagcctcctggagatgggcaac
gcggcgcggcacacgggagccacgcacctcaaccacctgtctagccgctcacacacggtc
ttcaccgtgaccctggagcagcgggggcgcgcccccagccgcctgccccgccccgccccg
ggccagctgctcgtctccaagttccacttcgtggacctggcgggctcagagagggtgctc
aagacgggcagcaccggcgagcggctcaaggagagcatccagatcaacagcagcctcctg
gcactgggcaacgtcatcagcgccctgggggaccctcagcgccggggcagccacatcccc
taccgcgactccaagatcacccggatcctcaaagactcgctgggcgggaacgccaagacg
gtgatgatcgcctgcgtcagcccttcctcctccgacttcgacgagaccctcaacaccctc
aactacgccagccgcgcccagaacatccgcaaccgcgccacgatcaactggcggcccgag
gccgagcggccacccgaagaggcggcgagcggcgcgcggggtccgccacggcaccgctcc
gagacccgcatcatccaccgcggccggggcgccccgggcccagccaccgcctccgcggcg
gccgccatgcgcctgggcgccgagtgcgcccgctaccgcgcctgcaccgacgccgcctac
agcctcctgcgcgagctgcaggccgagcccgggctgcccggcgccgccgcccgcaaggtg
cgcgactggctgtgcgccgtcgagggcgagcgcagcgccctgagctccgcctccgggccc
gacagcggcatcgagagcgcctccgtcgaggaccaggcggcgcagggggccggcgggcga
aaggaggatgagggggcgcagcagctgctgaccctgcagaaccaggtggcgcggctggag
gaggagaaccgagactttctggctgcgctggaggacgccatggagcagtacaaactgcag
agcgaccggctgcgtgagcagcaggaggagatggtggaactgcggctgcggttagagctg
gtgcggcctggctgggggggcccggggttcctgaatggcctgcctcccgggtcctttgtg
cctcgacctcatacagctcccctcgggggtgcccacgcccatgtgctgagcatggtgccc
cctgcctgcctccctggagatgaagttggctctgagcagaggggagagcaggtgacaaat
ggcagggaggctggagctgagttgctgactgaggtgaacaggctgggaagtggctcttca
gctgcttcagaggaggaagaggaggaggagctgcccaggcggaccttacacctgcgcaga
aatgggatcagcaactgcagtcagagggtgggggcccgcccagggagtctgccagagagg
aagggcccagagctttgccttgaagagttggatgcagccgttccagggtccagagcagtt
ggtgggagcaaggcccgggttcaggcccgccaggtcccctctgccacggcctcggagcgg
cggctggcccaggcccagcagaagatccgggagctggctattaacatccgcatgaaggag
gagctcattggcgagctggtccgcacaggaaaggcagctcaggccctgaaccgccagcac
agccagcgtatccgggagctggagcaggaggcagagcgggtgcgggccgagctgagtgaa
ggccagaggcagctgcgggagctcgagggcaaggagccccaggacgctggcgagcggtct
cggctccaggagttccgcaggagggtcgctgcggcccagagccaggtgcaggtgctgaag
gagaagaagcaggccacggagcggctggtgtcactgtcagcccagagtgagaagcgactg
caggagcttgagcggaacgtgcagctcatgcggcagcagcagggacagctgcagaggcgg
cttcgcgaggagacggagcagaagcggcgcctggaggcagagatgagcaagcggcagcac
cgtgtcaaggagctggagctgaagcacgagcagcagcagaagatcctgaagattaagacg
gaagagatcgcggccttccagaggaagaggcgcagtggcagcaacggctctgtggtcagc
ctggaacagcagcagaagattgaggagcagaagaagtggctggaccaggagatggagaag
gtgctacagcagcggcgggcgctggaggagctgggggaggagctccacaagcgggaggcc
atcctggccaagaaggaggccctgatgcaggagaagacggggctggagagcaagcgcctg
aggtccagccaggccctcaacgaggacatcgtgcgagtgtccagccggctggagcacctg
gagaaggagctgtccgagaagagcgggcagctgcggcagggcagcgcccagagccagcag
cagatccgcagggagatcgacagcctgcgccaggagaaggactcgctgctcaagcagcgc
ctggagatcgacagcaagctgcggcaggggagcctgctgtcccccgaggaggaacggaca
ctgttccagttggatgaggccatcgaggccctggatgccgccattgagtataagaatgag
gccatcacatgccgccagcgggtgcttcgggcctcagcctcgttgctgtcccagtgtgag
atgaacctcatggccaagctcagctacctctcatcctcagagaccagagccctcctctgc
aagtattttgacaaggtggtgacgctccgagaggagcagcaccagcagcagattgccttc
tcggaactggagatgcagctggaggagcagcagaggctggtgtactggctggaggtggcc
ctggagcggcagcgcctggagatggaccgccagctgaccctgcagcagaaggagcacgag
cagaacatgcagctgctcctgcagcagagtcgagaccacctcggtgaagggttagcagac
agcaggaggcagtatgaggcccggattcaagctctggagaaggaactgggccgctacatg
tggataaaccaggaactgaaacagaagctcggcggtgtgaatgctgtaggccacagcagg
ggcggggagaagaggagcctgtgctcggagggcagacaggctcctggaaatgaagatgag
ctccagccagcacccgagcttctctggctgtcccccctcactgagggggccccccgcacc
cgggaggagcgggacttggtccacgctccgttacccttgacctggaaacgctcgagcatg
tgtggcgaggagcaggggtccccaggggaactgaggcagcgggaggcggccgagcccctg
gtggggcgggtgcttcctgtgggtgaggcaggcctgccctggaactttgggcctttgtcc
aagccccggcgggaactgcgacgagccagcccggggatgattgatgtccggaaaaacccc
ctgtaa

DBGET integrated database retrieval system