KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100588483
Entry
100588483         CDS       T03265                                 

Gene name
BAK1
Definition
(RefSeq) bcl-2 homologous antagonist/killer isoform X1
  KO
K14021  Bcl-2 homologous antagonist/killer
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle01524  Platinum drug resistance
nle04141  Protein processing in endoplasmic reticulum
nle04210  Apoptosis
nle04215  Apoptosis - multiple species
nle05022  Pathways of neurodegeneration - multiple diseases
nle05132  Salmonella infection
nle05160  Hepatitis C
nle05162  Measles
nle05163  Human cytomegalovirus infection
nle05164  Influenza A
nle05165  Human papillomavirus infection
nle05167  Kaposi sarcoma-associated herpesvirus infection
nle05168  Herpes simplex virus 1 infection
nle05169  Epstein-Barr virus infection
nle05170  Human immunodeficiency virus 1 infection
nle05200  Pathways in cancer
nle05202  Transcriptional misregulation in cancer
nle05203  Viral carcinogenesis
nle05206  MicroRNAs in cancer
nle05210  Colorectal cancer
nle05212  Pancreatic cancer
nle05213  Endometrial cancer
nle05214  Glioma
nle05216  Thyroid cancer
nle05217  Basal cell carcinoma
nle05218  Melanoma
nle05220  Chronic myeloid leukemia
nle05222  Small cell lung cancer
nle05223  Non-small cell lung cancer
nle05224  Breast cancer
nle05225  Hepatocellular carcinoma
nle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:nle00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100588483 (BAK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100588483 (BAK1)
   04215 Apoptosis - multiple species
    100588483 (BAK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100588483 (BAK1)
   05202 Transcriptional misregulation in cancer
    100588483 (BAK1)
   05206 MicroRNAs in cancer
    100588483 (BAK1)
   05203 Viral carcinogenesis
    100588483 (BAK1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100588483 (BAK1)
   05212 Pancreatic cancer
    100588483 (BAK1)
   05225 Hepatocellular carcinoma
    100588483 (BAK1)
   05226 Gastric cancer
    100588483 (BAK1)
   05214 Glioma
    100588483 (BAK1)
   05216 Thyroid cancer
    100588483 (BAK1)
   05220 Chronic myeloid leukemia
    100588483 (BAK1)
   05217 Basal cell carcinoma
    100588483 (BAK1)
   05218 Melanoma
    100588483 (BAK1)
   05213 Endometrial cancer
    100588483 (BAK1)
   05224 Breast cancer
    100588483 (BAK1)
   05222 Small cell lung cancer
    100588483 (BAK1)
   05223 Non-small cell lung cancer
    100588483 (BAK1)
  09164 Neurodegenerative disease
   05022 Pathways of neurodegeneration - multiple diseases
    100588483 (BAK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100588483 (BAK1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100588483 (BAK1)
   05160 Hepatitis C
    100588483 (BAK1)
   05164 Influenza A
    100588483 (BAK1)
   05162 Measles
    100588483 (BAK1)
   05168 Herpes simplex virus 1 infection
    100588483 (BAK1)
   05163 Human cytomegalovirus infection
    100588483 (BAK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100588483 (BAK1)
   05169 Epstein-Barr virus infection
    100588483 (BAK1)
   05165 Human papillomavirus infection
    100588483 (BAK1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100588483 (BAK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:nle03029]
    100588483 (BAK1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:nle02000]
    100588483 (BAK1)
Mitochondrial biogenesis [BR:nle03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    100588483 (BAK1)
Transporters [BR:nle02000]
 Other transporters
  Pores ion channels [TC:1]
   100588483 (BAK1)
SSDB
Motif
Pfam: Bcl-2 Bcl-2_3 DUF5700
Other DBs
NCBI-GeneID: 100588483
NCBI-ProteinID: XP_030659347
LinkDB
Position
22a
AA seq 211 aa
MASGQGPGPPRQECGEPALPSASEEQVARDTEEVFRSYVFYRHQQEQEAEGAAAPADPEM
VTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQAMLQHLQPTAENVYEYFTKIASSLFE
SGINWGRVVALLAFGYRMALHVYQHGLTGFLGQVTRFVVDFMLHRCIARWIAQRGGWVAA
LDLGNGPILIVLVVLGVVLLGQFVVRRFFKS
NT seq 636 nt   +upstreamnt  +downstreamnt
atggcttcggggcaaggcccaggtcctcccaggcaggagtgcggagagcctgccctgccc
tctgcttctgaggagcaggtagcccgggacacagaggaggttttccgcagctacgttttt
taccgccatcagcaggaacaggaggctgaaggggcagctgcccctgccgacccagagatg
gtcaccttacctctgcaacccagcagcaccatggggcaggtgggacggcagctcgccatc
atcggggacgacatcaaccgacgctacgactcagagttccaggccatgttgcagcacctg
cagcccacggcagagaatgtctatgagtacttcaccaagattgcctccagcctgtttgag
agtggcatcaactggggccgtgtggtggctcttctggctttcggctaccgtatggcccta
cacgtctaccagcatggcctgactggcttcctgggccaggtgacccgcttcgtggttgac
ttcatgctgcatcgctgcattgcccggtggattgcacagaggggtggctgggtggcagcc
ctggacttgggcaatggtcccatcctgatcgtgctggtggttctgggtgtggttctgttg
ggccagtttgtggtacgaagattcttcaaatcatga

DBGET integrated database retrieval system