KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100588875Help
Entry
100588875         CDS       T03265                                 

Gene name
GAD1
Definition
(RefSeq) glutamate decarboxylase 1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle00250  Alanine, aspartate and glutamate metabolism
nle00410  beta-Alanine metabolism
nle00430  Taurine and hypotaurine metabolism
nle00650  Butanoate metabolism
nle01100  Metabolic pathways
nle04727  GABAergic synapse
nle04940  Type I diabetes mellitus
Module
nle_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:nle00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    100588875 (GAD1)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100588875 (GAD1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100588875 (GAD1)
   00430 Taurine and hypotaurine metabolism
    100588875 (GAD1)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    100588875 (GAD1)
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    100588875 (GAD1)
Enzymes [BR:nle01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     100588875 (GAD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase SepSecS DegT_DnrJ_EryC1 OKR_DC_1
Motif
Other DBs
NCBI-GeneID: 100588875
NCBI-ProteinID: XP_003254292
UniProt: G1QZH4
LinkDB All DBs
Position
22a
AA seq 594 aa AA seqDB search
MASSTPSSSATSSNTGADPNTTNLRPTTYDTWCGVAHGCTRKLGLKICGFLQRTNSLEEK
SRLVSAFKERQSSKNLLSCENSDRDARFRRTETDFSNLFARDLLPAKNGEEQTVQFLLEV
VDILLNYVRKTFDRSTKVLDFHHPHQLLEGMEGFNLELSDHPESLEQILVDCRDTLKYGV
RTGHPRFFNQLSTGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQITLKKMREIVGWS
SKDGDGIFSPGGAISNMYSIMAARYKYFPEVKTKGMAAVPKLVLFTSEHSHYSIKKAGAA
LGFGTDNVILIKCNERGKIIPADFEAKILEAKQKGYVPFYVNATAGTTVYGAFDPIQEIA
DICEKYNLWLHVDAAWGGGLLMSRKHRHKLNGIERANSVTWNPHKMMGVLLQCSAILIKE
KGILQGCNQMCAGYLFQPDKQYDVSYDTGDKAIQCGRHVDIFKFWLMWKAKGTVGFENQI
NKCLELAEYLYAKIKNREEFEMVFNGEPEHTNVCFWYIPQSLRGVPDSPQRREKLHKVAP
KIKALMMESGTTMVGYQPQGDKANFFRMVISNPAATQSDIDFLIEEIERLGQDL
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcttcgaccccatcttcgtccgcaacctcctcgaatacgggagcggaccccaat
accactaacctgcgccccacaacgtacgatacctggtgcggcgtggcccatggatgcacc
agaaaactggggctcaagatctgcggcttcttgcaaaggaccaacagcctggaagagaag
agtcgccttgtgagtgccttcaaggagaggcagtcctccaagaacctgctttcctgtgaa
aacagcgaccgggatgcccgcttccggcgcacagagacggacttctctaatctatttgct
agagatctgcttccggctaagaacggtgaggagcaaaccgtgcagttcctcctggaagtg
gtggatatactcctcaactatgtccgcaagacatttgatcgctccaccaaggtgctggac
ttccatcacccacaccagttgctggaaggcatggagggcttcaacttggagctctctgac
caccccgagtccctggagcagatcttggttgactgcagagacaccttgaaatatggggtt
cgcacaggtcatcctcgatttttcaaccagctctccactggattggatattattggccta
gctggagaatggctgacatcaacagccaataccaatatgtttacatatgaaattgcacca
gtgtttgtcctcatggaacaaataacacttaagaagatgagagagatagttggatggtca
agtaaagatggtgatgggatattttctcctgggggcgccatatccaacatgtacagcatc
atggctgctcgctacaagtacttcccggaagttaagacaaagggcatggcggctgtgccc
aaactggtcctcttcacctcagaacacagtcactattccataaagaaagccggggctgca
cttggctttggaactgacaatgtgattttgataaagtgcaatgaaagggggaaaataatt
ccagctgattttgaggcaaaaattcttgaagccaaacagaagggatatgttcccttttat
gtcaatgcaactgctggcacgactgtttatggagcttttgatccgatacaagagattgca
gatatatgtgagaaatataacctttggctgcatgtcgatgctgcctggggaggtgggctg
ctcatgtccaggaagcaccgccataaactcaatggcatagaaagggccaactcagtcacc
tggaaccctcacaagatgatgggcgtgctgttgcagtgctctgccattctcatcaaggaa
aagggtatactccaaggatgcaaccagatgtgtgcaggatacctcttccagccagacaag
cagtatgatgtctcctacgacaccggggacaaggcaattcagtgtggccgccacgtggat
atcttcaagttctggctgatgtggaaagcaaagggcacagtgggatttgaaaaccagatc
aacaaatgcctggaactggctgaatacctctatgccaagattaaaaacagagaagaattt
gagatggttttcaatggcgagcctgagcacacaaacgtctgtttttggtatattccacaa
agcctcaggggtgtgccagacagccctcagcgacgggaaaagctacacaaggtggctcca
aaaatcaaagccctgatgatggagtcaggcacgaccatggttggctaccagccccaaggg
gacaaggccaacttcttccggatggtcatctccaacccagccgctacccagtctgacatt
gacttcctcattgaggagatagaaagactgggccaggatctgtaa

DBGET integrated database retrieval system