KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100589003
Entry
100589003         CDS       T03265                                 

Gene name
NOS2
Definition
(RefSeq) nitric oxide synthase, inducible
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle00220  Arginine biosynthesis
nle00330  Arginine and proline metabolism
nle01100  Metabolic pathways
nle04020  Calcium signaling pathway
nle04066  HIF-1 signaling pathway
nle04146  Peroxisome
nle04371  Apelin signaling pathway
nle04926  Relaxin signaling pathway
nle05010  Alzheimer disease
nle05014  Amyotrophic lateral sclerosis
nle05022  Pathways of neurodegeneration - multiple diseases
nle05133  Pertussis
nle05140  Leishmaniasis
nle05142  Chagas disease
nle05145  Toxoplasmosis
nle05146  Amoebiasis
nle05152  Tuberculosis
nle05200  Pathways in cancer
nle05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:nle00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    100589003 (NOS2)
   00330 Arginine and proline metabolism
    100589003 (NOS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100589003 (NOS2)
   04066 HIF-1 signaling pathway
    100589003 (NOS2)
   04020 Calcium signaling pathway
    100589003 (NOS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    100589003 (NOS2)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100589003 (NOS2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100589003 (NOS2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100589003 (NOS2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100589003 (NOS2)
   05014 Amyotrophic lateral sclerosis
    100589003 (NOS2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    100589003 (NOS2)
   05152 Tuberculosis
    100589003 (NOS2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100589003 (NOS2)
   05145 Toxoplasmosis
    100589003 (NOS2)
   05140 Leishmaniasis
    100589003 (NOS2)
   05142 Chagas disease
    100589003 (NOS2)
Enzymes [BR:nle01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     100589003 (NOS2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 DUF1400 NAD_binding_6
Other DBs
NCBI-GeneID: 100589003
NCBI-ProteinID: XP_003277133
Ensembl: ENSNLEG00000001492
UniProt: G1QMC7
LinkDB
Position
19
AA seq 1153 aa
MACPWKFLFKTKFHHYAMNGEKDINNNVEKASCATSSPVTQDDLQYHRLSKQQNESPQPF
VETGKKSPESLVKLDATPLSSPRHVRIKNWGSGMTFQDTLHHKAKGILTCRSKSCLGSIM
TPKSLTRGPRDKPTPPDELLPQAIEFVNQYYGSFKEAKIEEHLARVEAVTKEIETTGTYQ
LTGDELIFATKQAWRNAPRCIGRIQWSNLQVFDARSCSTAQEMFEHICRHVRYSTNNGNI
RSAITVFPQRSDGKHDFRVWNAQLIRYAGYQMPDGSIRGDPANVEFTQLCIDLGWKPKYG
RFDVVPLVLQADGRDPELFEIPPDLVLEVAMEHPKYEWFRELELKWYALPAVANMLLEVG
GLEFPACPFNGWYMGTEIGVRDFCDVQRYNILEEVGRRMGLETHKLASLWKDQAVVEINI
AVLHSFQKQNVTIMDHHSAAESFMKYMQNEYRSRGGCPADWIWLVPPMSGSITPVFHQEM
LNYVLSPFYYYQVEAWKTHVWQDEKRRPRRREIPLKVLVKAVLFACMLMRKTMASRVRVT
ILFATETGKSEALAWDLGALFSCAFNPKVVCMDKYRLSCLEEERLLLVVTSTFGNGDCPS
NGEKLKKSLFMLKELNNKFRYAVFGLGSSMYPRFCAFAHDIDQKLSHLGASQLTPTGEGD
ELSGQEDAFRSWAVQTFKAACETFDVRGKQHIQIPKLYTSNVTWDPHRYRLVQDSQPLDL
SKALSSMHAKNVFTMRLKSRQNLQSPTSSRATILVELSCEEGQGLNYLPGEHLGVFPGNQ
PALVQGILERVVDNPAPHQTVRLEALDESGSYWVSDKRLPPCSLSQALTYFLDITTPPTQ
LLLQKLAQVATEDPERQRLEALCQPSEYSKWKFTNSLTFLEVLEEFPSLRVSADFLLSQL
PILKPRFYSISSSQDHTPTEIHLTVAVVTYHTRDGQGPLHHGVCSTWLNSLKPQDPVPCF
VRNASGFHLPEDPSHPCILIGPGTGIAPFRSFWQQRLHDSQHKGVRGGRMTLVFGCRRPD
EDHIYQEEMLEMAQKGVLHAVHTAYSRLPGKPKVYVQDILRQQLASEVLRVLHEEPGHLY
VCGDVRMARDVAHTLKQLVAAKLKLNEEQAEDYFFQLKSQKRYHEDIFGAVFPYEVKKDR
AAVQPSSLEMSAL
NT seq 3462 nt   +upstreamnt  +downstreamnt
atggcctgtccttggaaatttctgttcaagaccaaattccaccactatgcaatgaatgga
gaaaaagacatcaacaacaacgtggagaaagcctcctgtgccacctccagtccagtgaca
caggatgacctccagtatcacaggctcagcaagcagcagaatgagtccccgcagcccttc
gtggagacgggaaagaagtctccagaatctctggtcaagctggatgcgaccccattgtcc
tccccacggcatgtgaggatcaaaaactggggcagtgggatgactttccaagacacactt
caccacaaggccaaagggattttgacttgcaggtccaaatcttgcctggggtccattatg
actcccaaaagtttgaccagaggacccagggacaagcctacccctccagatgagcttcta
cctcaagctatcgaatttgtcaaccaatattacggctccttcaaagaggcaaaaatagag
gaacatctggccagggtggaagcggtaacaaaggagatagaaacaacaggaacctaccaa
ctgacgggagatgagctcatcttcgccaccaagcaggcctggcgcaatgccccacgctgc
attgggaggatccagtggtccaacctgcaggtctttgatgcccgcagctgttccaccgcc
caggaaatgtttgaacacatctgcagacacgtgcgttactccaccaacaatggcaacatc
aggtcggccatcaccgtgttcccccagcggagtgatggcaagcacgacttccgggtgtgg
aatgctcagctcatccgctatgctggctaccagatgccagatggcagcatcagaggggac
cctgccaacgtggaattcactcagctgtgcatcgacctgggctggaagcccaagtacggc
cgcttcgatgtggtccccctggtcctgcaggccgatggccgtgaccctgagctcttcgaa
atcccacctgaccttgtgcttgaggtggccatggaacatcctaaatacgagtggtttcgg
gaactggagctaaagtggtacgccctgcctgcagtggccaacatgctgctcgaggtgggc
ggcctggagttcccagcgtgccccttcaatggctggtacatgggcacagagatcggagtc
cgggacttctgtgacgtccagcgctacaacatcctggaggaagtgggcaggagaatgggc
ttggaaacgcacaagctggcctcgctctggaaagaccaggctgtcgttgagatcaacatt
gctgtgctccatagtttccagaagcagaatgtgaccatcatggaccaccactcggctgca
gaatccttcatgaagtacatgcagaatgaataccggtcccgtgggggctgcccggcagac
tggatttggctggtccctcccatgtctgggagcatcacccccgtgtttcaccaggagatg
ctgaactatgtcctgtcccctttctactactatcaggtagaggcctggaaaacccatgtc
tggcaggacgagaagcggagacccaggagaagagagattccattgaaagtcttggtgaaa
gctgtgctctttgcctgtatgctgatgcgcaagacaatggcgtcccgagtcagagtcacc
atcctctttgcgacagagacaggaaaatcagaggcgctggcctgggatctgggggccttg
ttcagctgtgccttcaatcccaaggttgtctgcatggataagtacaggctgagctgcctg
gaggaagagcggctgctgttggtggtgaccagtacctttggcaatggagactgccccagc
aatggagagaaactgaagaaatcgctcttcatgctgaaagagctcaacaacaaattcagg
tacgctgtgtttggcctcggctccagcatgtaccctcggttctgcgcctttgctcatgac
attgatcagaagctgtcccacctgggggcctctcagctcaccccgactggagaaggggat
gagctcagcgggcaggaggatgccttccgcagctgggccgtgcaaaccttcaaggcagcc
tgtgagacgtttgatgtccgaggcaaacagcacattcagatccccaagctctacacctcc
aacgtgacctgggacccgcaccgctacaggcttgtgcaggactcacagcctttggacctc
agcaaagccctcagcagcatgcacgccaagaatgtgttcaccatgaggctcaaatctcgg
cagaatctacagagtccaacatccagccgtgccaccatcctggtggaactctcctgtgag
gagggccaaggcctgaactacctgccgggggagcatcttggggttttcccaggcaaccag
ccggccctcgtccaaggcatcctggagcgagtggtggacaaccctgcgccccaccagaca
gtgcgcctggaggccctggatgagagcggcagctactgggtcagtgacaagaggctgccc
ccctgctcactcagccaggccctcacctacttcctggacatcaccactcccccgacccag
ctgctgctccaaaagctggcccaggtggccacagaagacccggagagacagaggctggag
gccttgtgtcagccctcagagtacagcaagtggaagttcaccaacagcctcacgttcctg
gaggtgctagaggagttcccatccctgcgggtgtctgctgacttcctgctttcccagctc
cccattctgaagcccaggttctactctatcagctcctcccaggatcacacgcccacagag
atccacctgactgtggccgtggtcacctaccacacccgagatggccagggtcccctgcac
catggcgtctgcagcacatggctcaacagcctgaagccccaagacccagtgccctgcttt
gtgcggaatgccagcggcttccacctccccgaggacccctcccatccttgcatcctcatc
gggcctggcacaggcatcgcgcccttccgcagtttctggcagcagcggctccatgactcc
cagcacaagggagtgcggggaggccggatgaccttggtgtttgggtgccgccgcccagat
gaagaccacatctaccaggaggagatgctggagatggcccagaagggggtgctgcatgcg
gtgcacacagcctattcccgtctgcctggcaagcccaaggtctatgttcaggacatcctg
cggcagcagctggccagcgaggtgctccgtgtgctccatgaggagccgggccacctctat
gtttgcggggatgtgcgcatggcccgggacgtggcccacaccctgaagcagctggtggct
gccaagctgaaactgaatgaggagcaggctgaggactatttctttcagctcaagagccag
aagcgctatcatgaagatatctttggtgctgtatttccctacgaggtgaagaaggacagg
gcagcggtgcagcccagcagcctggagatgtcagcgctctga

DBGET integrated database retrieval system