KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100589125Help
Entry
100589125         CDS       T03265                                 

Gene name
HDAC6
Definition
(RefSeq) histone deacetylase 6
  KO
K11407  histone deacetylase 6 [EC:3.5.1.98]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle05034  Alcoholism
nle05165  Human papillomavirus infection
nle05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:nle00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100589125 (HDAC6)
  Substance dependence
   05034 Alcoholism
    100589125 (HDAC6)
  Infectious diseases
   05165 Human papillomavirus infection
    100589125 (HDAC6)
Enzymes [BR:nle01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100589125 (HDAC6)
Protein phosphatases and associated proteins [BR:nle01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100589125 (HDAC6)
Messenger RNA biogenesis [BR:nle03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     100589125 (HDAC6)
Membrane trafficking [BR:nle04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    100589125 (HDAC6)
Chromosome and associated proteins [BR:nle03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     100589125 (HDAC6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl zf-UBP
Motif
Other DBs
NCBI-GeneID: 100589125
NCBI-ProteinID: XP_012354052
LinkDB All DBs
Position
X
AA seq 844 aa AA seqDB search
MTSTGQDSTTTRQRRSRQNPQSPPQDSSVTSKRNIKKGAVPRSIPNLAEVKKKGKMKKLG
QAVEEDLIVGLQGMDLNLEAEALAGTGLVLDEQLNEFHCLWDDSFPEGPERLHAIKEQLI
QEGLLDRCVSFQARFAEKEELMLVHSLEYIDLMETTQYMNEGELRVLADTYDSVYLHPNS
YSCACLASGSVLRLVDAVLGAEIRNGMAIIRPPGHHAQHSLMDGYCMFNHVAVAARYAQQ
KHRIRRVLIVDWDVHHGQGTQFTFDQDPSVLYFSIHRYEQGRFWPHLKASNWSTTGFGQG
QGYTINVPWNQVGMRDADYIAAFLHVLLPVALEFQPHLVLVAAGFDALQGDPKGEMAATP
AGFAQLTHLLMGLAGGKLILSLEGGYNLRALAEGVSASLHTLLGDPCPMLESPGAPCRSA
QASVSCALEALEPFWEVLVRSTETVEGDNMEEDNVEESEEEGPWEPPALPILTWPVLQSR
TGLVYHQSMMNHCNLWDSHHPEVPQRILRIMCRLEELGLAGRCLTLTPRPATEAELLTCH
SAEYVDHLRATEKMKTRELHRESSNFDSIYICPSTFACAQLATGAACRLVEAVLSGEVLN
GAAVVRPPGHHAEQDAACGFCFFNSVAVAARHAQAISGRALRGGTELIQTPLASSTDHQP
PPTSPVQGTTPQISPSTLIGSLRTLELGSESQGASESQAPGEENLLGEAAGGQDMADSML
MQGSRGLTDQAIFYAVTPLPWCPHLVAVCPIPAAGLDVTQPCGDCGTIQENWVCLSCYQV
YCGRYINGHMLQHHGNSGHPLVLSYIDLSAWCYYCQAYVHHQALLDVKNIAHQNKFGEDM
PHPH
NT seq 2535 nt NT seq  +upstreamnt  +downstreamnt
atgacctccaccggccaggattccaccacaaccaggcagcgaagaagtaggcagaacccc
cagtcgccccctcaggactccagtgtcacttcgaagcgaaatattaaaaagggagccgtt
ccccgctccatccccaatctagcggaggtaaagaagaaaggcaaaatgaagaagctcggc
caagcagtggaagaagacctaatcgtgggactgcaagggatggatctgaaccttgaggct
gaagcactggctggcactggcttggtgttggatgagcagctaaatgaattccattgcctc
tgggatgacagcttcccggaaggccctgagcggctccatgccatcaaggagcaactgatc
caggagggcctcctagatcgctgcgtgtcctttcaggcccggtttgctgaaaaggaagag
ctgatgttggttcacagcctagaatatattgatctgatggaaacaacccagtacatgaat
gagggagaactccgtgtcctagcagacacctacgactcagtttatctgcatccgaactca
tactcctgtgcctgcctggcctcaggctctgtcctcaggctggtggatgcggtcctgggg
gctgagatccggaatggcatggccatcattaggcctcctggacatcacgcccagcacagt
cttatggatggctattgcatgttcaaccacgtggctgtggcagcccgctatgctcaacag
aaacaccgcatccggagggtccttatcgtagattgggatgtgcaccacggtcaaggaaca
cagttcaccttcgaccaggaccccagtgtcctctatttctccatccaccgctacgagcag
ggtaggttctggccccacctgaaggcctctaactggtccaccacaggtttcggccaaggc
caaggatataccatcaatgtgccttggaaccaggtggggatgcgggatgctgactacatt
gctgctttcctgcacgtcctgctgccagtcgccctcgagttccagcctcatctggtcctg
gtggctgctggatttgatgccctgcaaggggaccccaagggtgagatggccgccactccg
gcagggttcgcccagctaacccacctgctcatgggtctggcaggaggcaagctgatcctg
tctctggagggtggctacaacctccgtgccctggctgaaggtgtcagtgcttcgctccac
acccttctgggagacccttgccccatgctggagtcacctggtgccccctgccggagtgcc
caagcttcagtttcctgtgctctggaagcccttgagcccttctgggaggttcttgtgaga
tcaactgagaccgtggagggggacaacatggaggaggacaatgtagaggagagcgaggag
gaaggaccctgggagccccctgcgctcccaatcctgacgtggccagtgctacagtctcgc
acagggctggtctatcaccaaagtatgatgaatcactgcaacttgtgggacagccaccac
cctgaggtaccccagcgcatcttgcggatcatgtgccgtctggaggagctgggccttgcc
gggcgctgcctcaccctgacaccacgccctgccacagaggctgagctgctcacctgccac
agtgctgagtacgtggatcatctccgggccacagagaaaatgaaaacccgggagctgcac
cgtgagagttccaactttgactccatctatatctgccccagtaccttcgcctgtgcacag
cttgccactggcgctgcctgccgcctggtggaggctgtgctgtcaggagaggttctgaat
ggtgctgctgtggtgcgtcccccaggacaccacgcggagcaggatgcagcttgcggtttt
tgctttttcaactctgtggctgtggctgctcgccatgcccaggctatcagtgggcgtgcc
ctacgagggggcaccgagctgatccaaactcctctagcctcgagcacagaccaccaaccc
cccccaacctcacctgtgcagggaactacaccccagatatctcccagtacactgattggg
agtctcaggaccttggagctaggcagcgaatctcagggggcctcagaatctcaggcccca
ggagaggagaacctactaggagaggcagctggaggtcaggacatggctgattcgatgctg
atgcagggatctaggggcctcactgatcaggccatattttatgctgtgacaccactgccc
tggtgtccccatttggtggcagtatgccccatacctgcagcaggcctagacgtgacccaa
ccttgtggggactgtggaacaatccaagagaattgggtgtgtctctcttgctatcaggtc
tactgtggtcgttacatcaatggccacatgctccaacaccatggaaattctggacacccg
ctggtcctcagctacatcgacctgtcagcctggtgttactactgtcaggcctatgtccac
caccaggctctcctagatgtgaagaacatcgcccaccagaacaagtttggggaggatatg
ccccacccacactaa

DBGET integrated database retrieval system