KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100589322
Entry
100589322         CDS       T03265                                 

Gene name
MYC
Definition
(RefSeq) myc proto-oncogene protein
  KO
K04377  Myc proto-oncogene protein
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04010  MAPK signaling pathway
nle04012  ErbB signaling pathway
nle04110  Cell cycle
nle04151  PI3K-Akt signaling pathway
nle04218  Cellular senescence
nle04310  Wnt signaling pathway
nle04350  TGF-beta signaling pathway
nle04390  Hippo signaling pathway
nle04550  Signaling pathways regulating pluripotency of stem cells
nle04630  JAK-STAT signaling pathway
nle04919  Thyroid hormone signaling pathway
nle05132  Salmonella infection
nle05160  Hepatitis C
nle05161  Hepatitis B
nle05163  Human cytomegalovirus infection
nle05166  Human T-cell leukemia virus 1 infection
nle05167  Kaposi sarcoma-associated herpesvirus infection
nle05169  Epstein-Barr virus infection
nle05200  Pathways in cancer
nle05202  Transcriptional misregulation in cancer
nle05205  Proteoglycans in cancer
nle05206  MicroRNAs in cancer
nle05210  Colorectal cancer
nle05213  Endometrial cancer
nle05216  Thyroid cancer
nle05219  Bladder cancer
nle05220  Chronic myeloid leukemia
nle05221  Acute myeloid leukemia
nle05222  Small cell lung cancer
nle05224  Breast cancer
nle05225  Hepatocellular carcinoma
nle05226  Gastric cancer
nle05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100589322 (MYC)
   04012 ErbB signaling pathway
    100589322 (MYC)
   04310 Wnt signaling pathway
    100589322 (MYC)
   04350 TGF-beta signaling pathway
    100589322 (MYC)
   04390 Hippo signaling pathway
    100589322 (MYC)
   04630 JAK-STAT signaling pathway
    100589322 (MYC)
   04151 PI3K-Akt signaling pathway
    100589322 (MYC)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100589322 (MYC)
   04218 Cellular senescence
    100589322 (MYC)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100589322 (MYC)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100589322 (MYC)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100589322 (MYC)
   05202 Transcriptional misregulation in cancer
    100589322 (MYC)
   05206 MicroRNAs in cancer
    100589322 (MYC)
   05205 Proteoglycans in cancer
    100589322 (MYC)
   05230 Central carbon metabolism in cancer
    100589322 (MYC)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100589322 (MYC)
   05225 Hepatocellular carcinoma
    100589322 (MYC)
   05226 Gastric cancer
    100589322 (MYC)
   05216 Thyroid cancer
    100589322 (MYC)
   05221 Acute myeloid leukemia
    100589322 (MYC)
   05220 Chronic myeloid leukemia
    100589322 (MYC)
   05219 Bladder cancer
    100589322 (MYC)
   05213 Endometrial cancer
    100589322 (MYC)
   05224 Breast cancer
    100589322 (MYC)
   05222 Small cell lung cancer
    100589322 (MYC)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100589322 (MYC)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100589322 (MYC)
   05161 Hepatitis B
    100589322 (MYC)
   05160 Hepatitis C
    100589322 (MYC)
   05163 Human cytomegalovirus infection
    100589322 (MYC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100589322 (MYC)
   05169 Epstein-Barr virus infection
    100589322 (MYC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:nle03000]
    100589322 (MYC)
   03019 Messenger RNA biogenesis [BR:nle03019]
    100589322 (MYC)
Transcription factors [BR:nle03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Myc
    100589322 (MYC)
Messenger RNA biogenesis [BR:nle03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     100589322 (MYC)
SSDB
Motif
Pfam: Myc_N Myc-LZ HLH TRH
Other DBs
NCBI-GeneID: 100589322
NCBI-ProteinID: XP_003256251
LinkDB
Position
16
AA seq 439 aa
MPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPP
LSPSRRSGLCSPSYVAVTPFSPRGDNDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPD
DETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPNPARGHSVCSTSSLYLQD
LSAAASECIDPSVVFPYPLNDSSSPKSCASPDSSAFSPSSDSLLSSTESSPQASPEPLVL
HEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAGGHSKPPHSPLVLKRC
HVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSPRSSDTEENDKRRTHN
VLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQGEEQKLTSEKDLL
RKRREQLKHKLEQLRNSCA
NT seq 1320 nt   +upstreamnt  +downstreamnt
atgcccctcaacgttagcttcaccaacaggaactatgacctcgactacgactcggtgcag
ccgtatttctactgcgacgaggaggagaacttctaccagcagcagcagcagagcgagctg
cagcccccggcgcccagcgaggatatctggaagaaattcgagctgctgcccaccccgccc
ctgtcccctagccgccgctccgggctctgctcgccctcctacgttgcggtcacgcccttc
tcccctcggggagacaacgacggcggtggcgggagcttctccacggccgaccagctggag
atggtgaccgagctgctgggaggagacatggtgaaccagagtttcatctgcgacccggac
gacgagaccttcatcaaaaacatcatcatccaggactgtatgtggagcggcttctcggcc
gccgccaagctcgtctccgagaagctggcctcctaccaggctgcgcgcaaagacagcggc
agcccgaaccccgcccgcggccacagcgtctgctccacctccagcttgtacctgcaggat
ctgagcgccgccgcctcagagtgcatcgacccctcggtggtcttcccctaccctctcaac
gacagcagctctcccaagtcctgcgcctcgccggactccagcgccttctctccgtcctcg
gattctctgctctcctcgacggagtcctcccctcaggccagcccggagcccctggtgctc
catgaggagacaccgcccaccaccagcagcgactctgaggaagaacaagaagatgaggaa
gaaatcgatgttgtttctgtggaaaagaggcaggctcctggcaaaaggtcagagtctgga
tcaccttctgctggaggacacagcaaacctcctcacagcccactggtcctcaagaggtgc
cacgtctccacacatcagcacaactacgcagcgcctccctccactcggaaggactatcct
gctgccaagagggtcaagttggacagtgtcagagtcctgagacagatcagcaacaaccga
aaatgcaccagccccaggtcctcagacaccgaggagaatgacaagaggcgaacacacaac
gtcttggagcgccagaggaggaatgagctaaaacggagcttttttgccctgcgtgaccag
atccctgagttggaaaacaatgaaaaggcccccaaggtagttatccttaaaaaagccaca
gcatacatcctgtccgtccaaggagaggagcaaaagctcacttctgaaaaggacttgttg
cggaaacgacgagaacagttgaaacacaaacttgaacagctacggaactcttgtgcataa

DBGET integrated database retrieval system