KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100589482
Entry
100589482         CDS       T03265                                 

Gene name
AXIN2
Definition
(RefSeq) axin-2 isoform X1
  KO
K04385  axin 2
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04310  Wnt signaling pathway
nle04390  Hippo signaling pathway
nle04550  Signaling pathways regulating pluripotency of stem cells
nle04934  Cushing syndrome
nle05010  Alzheimer disease
nle05022  Pathways of neurodegeneration - multiple diseases
nle05165  Human papillomavirus infection
nle05200  Pathways in cancer
nle05210  Colorectal cancer
nle05213  Endometrial cancer
nle05217  Basal cell carcinoma
nle05224  Breast cancer
nle05225  Hepatocellular carcinoma
nle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100589482 (AXIN2)
   04390 Hippo signaling pathway
    100589482 (AXIN2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100589482 (AXIN2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100589482 (AXIN2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100589482 (AXIN2)
   05225 Hepatocellular carcinoma
    100589482 (AXIN2)
   05226 Gastric cancer
    100589482 (AXIN2)
   05217 Basal cell carcinoma
    100589482 (AXIN2)
   05213 Endometrial cancer
    100589482 (AXIN2)
   05224 Breast cancer
    100589482 (AXIN2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100589482 (AXIN2)
   05022 Pathways of neurodegeneration - multiple diseases
    100589482 (AXIN2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100589482 (AXIN2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100589482 (AXIN2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:nle03036]
    100589482 (AXIN2)
Chromosome and associated proteins [BR:nle03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    100589482 (AXIN2)
SSDB
Motif
Pfam: RGS DIX AXIN1_TNKS_BD Axin_b-cat_bind DUF4827
Other DBs
NCBI-GeneID: 100589482
NCBI-ProteinID: XP_030656540
LinkDB
Position
19
AA seq 843 aa
MSSAMLVTRLPDPSSSFREDAPRPPVPGEEGETPPCQPGVGKGQVTKPMPVSSNTRRNED
GLGEPEGRASPDSPLTRWTKSLHSLLGDQDGAYLFRTFLEREKCVDTLDFWFACNGFRQM
NLKDTKTLRVAKAIYKRYIENNSIVSKQLKPATKTYIRDGIKKQQIDSIMFDQAQTEIQS
VMEENAYQMFLTSDIYLEYVRSGGENTAYMSNGGLGSLKVVCGYLPTLNEEEEWTCADFK
CKLSPTVVGLSSKTLRATASVRSTETVDSGYRSFKRSDPVNPYHVGSGYVFAPATSANDS
EISSDALTDDSMSMTDSSVDGIPPYRVGSKKQLQREMHRSVKANGQVSLPHFPRTHRLPK
EMTPVEPATFAAELISRLEKLKLELESRHSLEERLQQIREDEEKEGSELTLSSREGAPTQ
HPLSLLPSGTYEEDPQTILDDHLSRVLKTPGCQSPGVGRYSPRSRSPDHHHHHHSQYHSL
LLPGGKLPPAAASPGACPLLGGKGFVTKQTTKHVHHHYIHHHAVPKTKEEIEAEATQRVH
CFCPGGTEYYCYSKCKSHPKAPETMSSEQFGGSRGSTLPKRNGKGTEPGLALPAREGGAP
GGAGALQLPREEGDRSQDVWQWMLESERQSKPKPHSAQSTKKAYPLESARSSPGERASRH
HLWGGNNGHPRTTPRAHLFTQDPAMPPLTPPNTLAQLEEACRRLAEVSKPPKQRCCVASQ
QRDRNHSATVQVGATPFSNPSLAPEDHKEPKKLAGVHALQASELVVTYFFCGEEIPYRRM
LKAQSLTLGHFKEQLSKKGNYRYYFKKASDEFACGAVFEEIWEDETVLPMYEGRILGKVE
RID
NT seq 2532 nt   +upstreamnt  +downstreamnt
atgagtagcgctatgttggtgactcgcctcccggaccccagcagcagcttccgtgaggat
gccccgcggcccccagtgccaggggaagaaggggagaccccaccgtgtcagccaggggtg
ggcaagggccaggtcaccaaacccatgcctgtctcttccaacaccaggcggaacgaagat
gggttgggggagccggaggggcgggcatctccggattcccctctgactcggtggaccaag
tccttacactccttgttgggcgatcaagacggtgcttacctgttccgaactttcctggag
agggagaaatgcgtggataccttagatttctggtttgcctgcaatggattcaggcagatg
aacctgaaggataccaaaactttacgagtagccaaagcgatctacaaaaggtacatcgag
aacaacagcattgtctccaagcagctgaagcctgccaccaagacctacataagagatggc
atcaagaagcagcagattgattccatcatgtttgaccaggcgcagaccgagatccagtcg
gtgatggaggaaaatgcctaccagatgtttctgacttctgatatatacctcgaatatgtg
aggagtgggggagaaaacacagcttacatgagtaatgggggactcgggagcctaaaggtc
gtgtgcggctatctccccaccttgaacgaagaagaggagtggacttgtgccgacttcaag
tgcaaactttcgccaactgtggttggcttgtccagcaaaactctgagggcgacagcgagt
gtgaggtccacggaaactgttgacagtggatacaggtccttcaagaggagcgatcctgtt
aatccttatcatgtaggttctggctatgtctttgcgccagccaccagcgccaacgacagt
gagatatccagcgatgcgctgacggatgattccatgtccatgacggacagcagtgtagat
ggaattcctccttatcgtgtgggcagtaagaaacagctccagagagaaatgcatcgcagt
gtgaaggccaatggccaagtgtctctacctcatttcccgagaacccaccgcctgcccaag
gagatgacccccgtggaacccgccacctttgcagctgagctgatctcgaggctggagaag
ctgaagctggagttggagagccgccacagcctggaggagcgcctgcagcagatccgagag
gatgaagagaaggagggctccgagctcacactcagttcgcgggagggggcgcccacgcag
caccccctctccctactgccctccggcacctacgaggaagacccgcagacaatactggac
gatcacctgtccagggtcctcaagacccctggctgccagtctccgggcgtaggccgctat
agcccacgctcccgctccccggaccaccaccaccaccaccattcgcagtaccactccctg
ctcctgcccggtggcaagctgcctcccgcggccgcctcgccgggcgcctgccccctcctc
gggggcaagggctttgtgaccaagcagacgacgaagcatgtccaccaccactacatccac
caccacgccgtccccaagaccaaggaggagatcgaggcggaggccacgcagcgggtgcac
tgcttctgccctgggggcaccgagtattattgctactcgaaatgcaaaagccaccccaag
gctccggaaaccatgtccagcgagcagtttggcggcagcagaggcagtaccttgcccaaa
cgcaatgggaaaggcacggagccgggcctggccctgcccgccagggaaggaggggccccc
ggcggagctggggccctgcagcttccccgggaggaaggagacaggtcgcaggatgtctgg
cagtggatgctggagagtgagcggcagagcaagcccaagccccatagtgcccaaagcaca
aaaaaggcctaccccttggagtctgcccgctcgtctccaggcgaacgagccagccggcac
catctgtgggggggcaacaatgggcacccccgcaccaccccccgtgcccacctgtttacc
caggaccctgcgatgcctcccctgaccccacccaacactctggctcagctggaggaggcc
tgtcgcaggctggctgaggtgtcgaagcccccaaagcagcggtgctgtgtggccagtcag
cagagggacaggaaccactcggccactgttcaggtgggagccacgcccttctccaatcca
agcctggctccagaagatcacaaagagccaaagaaactggcaggtgtccatgcgctccag
gccagtgagttggttgtcacttactttttctgtggggaagaaattccataccggaggatg
ctgaaggctcagagcttgaccctgggccactttaaagagcagctcagcaaaaagggaaat
tataggtattacttcaaaaaagcaagcgatgagtttgcctgtggagcggtgtttgaggag
atctgggaggatgagacggtgctcccgatgtatgaaggccggattctgggcaaagtggag
cggatcgattga

KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 101179424
Entry
101179424         CDS       T03265                                 

Gene name
AXIN1
Definition
(RefSeq) axin-1 isoform X1
  KO
K02157  axin 1
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04310  Wnt signaling pathway
nle04390  Hippo signaling pathway
nle04550  Signaling pathways regulating pluripotency of stem cells
nle04934  Cushing syndrome
nle05010  Alzheimer disease
nle05022  Pathways of neurodegeneration - multiple diseases
nle05165  Human papillomavirus infection
nle05200  Pathways in cancer
nle05210  Colorectal cancer
nle05213  Endometrial cancer
nle05217  Basal cell carcinoma
nle05224  Breast cancer
nle05225  Hepatocellular carcinoma
nle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101179424 (AXIN1)
   04390 Hippo signaling pathway
    101179424 (AXIN1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    101179424 (AXIN1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101179424 (AXIN1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101179424 (AXIN1)
   05225 Hepatocellular carcinoma
    101179424 (AXIN1)
   05226 Gastric cancer
    101179424 (AXIN1)
   05217 Basal cell carcinoma
    101179424 (AXIN1)
   05213 Endometrial cancer
    101179424 (AXIN1)
   05224 Breast cancer
    101179424 (AXIN1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101179424 (AXIN1)
   05022 Pathways of neurodegeneration - multiple diseases
    101179424 (AXIN1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101179424 (AXIN1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    101179424 (AXIN1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:nle01009]
    101179424 (AXIN1)
Protein phosphatases and associated proteins [BR:nle01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101179424 (AXIN1)
SSDB
Motif
Pfam: DIX RGS AXIN1_TNKS_BD Axin_b-cat_bind
Other DBs
NCBI-GeneID: 101179424
NCBI-ProteinID: XP_030654553
Ensembl: ENSNLEG00000008050
LinkDB
Position
18
AA seq 867 aa
MNIQEQGFPLDLGASFTEDAPRPPVPGEEGELVSADPRPASYSFCPGKGVGIKGETSTAT
PRRSDLDLGYEPEGSASPTPPYLKWAESLHSLLDDQDGISLFRTFLKQEGCADLLDFWFA
CTGFRKLEPCDSNEEKRLKLARAIYRKYILDNNGIVSRQTKPATKSFIKGCIMKQLIDPA
MFDQAQTEIQATMEENTYPSFLKSDIYLEYTRTGSESPKVCSDQSSGSGTGKGMSGYLPT
LNEDEEWKCDQDMDEDDSRDAAPPGRLPQKLLLETAAPRASSSRRYSEGREFRYGSWREP
VNPYYVNAGYALAPATSANDSEQQSLSSDADTLSLTDSSVDGIPPYRIRKQHRREMQESV
QVNGRVPLPHIPRTYRVPKEVRVEPQKFAQELIHRLEAVQRTREAEEKLEERLKRVRMEE
EGEDGDPSSGPPGPCHKLPPAPAWHHFPPRCVDVGCAGLRDAHEENPESILDEHVQRVLR
TPGRQSPGPGHRSPDSGHVAKMPVALGGAASGHGKHAPKSGAKLDAAGLHHHRHIHHHVH
HSTARPKEQVEAEAARRAQSSFAWGPEPHSHGAKSRGYSENVGAAPNTSDGLAHSGKAGM
ACKRNVKKAESGKSASTEVPGASEDAEKNQKIMQWIIEGEKEISRHRRTGHGSSGMRKPQ
PHENSRPLSLERPGAVHPWVGPQLRTSVQPSHLFIQDPTMPPHPAPNPLTQLEEARRRLE
EEEKRASRAPSKQRYVQEVMRRGRACVRPACAPVLRVVPAVSDMELSETETRSQRKAGGG
SAQPCDSIVVAYYFCGEPIPYRTLVRGRAVTLGQFKELLTKKGSYRYYFKKVSDEFDCGV
VFEEVREDEAVLPVFEEKIIGKVEKVD
NT seq 2604 nt   +upstreamnt  +downstreamnt
atgaatatccaagagcagggtttccccttggacctcggagcaagtttcaccgaagatgct
ccccgacccccagtgcctggtgaggagggagaactggtgtccgcagacccgaggcccgcc
agctacagtttctgccccgggaaaggcgttggcattaaaggtgagacttcgacggccact
ccgaggcgctcggatctggacctggggtatgagcctgagggcagtgcctcccccacccca
ccatacttgaagtgggctgagtcactgcactccctgctggatgaccaagatgggataagc
ctgttcaggactttcctgaagcaggagggctgtgccgacttgctggacttctggtttgcc
tgcactggcttcaggaagctggagccctgtgactcgaacgaggagaagaggctgaagctg
gcgagagccatctaccgaaagtacattcttgataacaatggcatcgtgtcccggcagacc
aagccagccaccaagagcttcataaagggctgcatcatgaagcagctgatcgatcctgcc
atgtttgaccaggcccagacagaaatccaggccaccatggaggaaaacacctatccctcc
ttccttaagtctgatatttatttggaatatacgaggacaggctcggagagcccgaaagtc
tgtagtgaccagagctctgggtcagggacagggaagggcatgtctggatacctgccgact
ttaaatgaagatgaggaatggaagtgtgaccaggacatggacgaggacgacagcagagac
gcggctcctcccggaagactccctcagaagctgctcctggagacagctgccccgagggcc
tcctccagtagacggtacagcgaaggcagagagttcaggtatggatcctggcgggagcca
gtcaacccctattatgtcaatgccggctacgccctggcgccagccaccagtgccaacgac
agtgagcagcagagcctgtccagcgatgcagacaccctgtccctcacggacagcagcgtg
gatgggatccccccatacaggatccgtaagcagcaccgcagggagatgcaggagagcgtg
caggtcaatgggcgggtgcccctacctcacattccccgcacgtaccgggtgccgaaggag
gtccgcgtggagccccagaagttcgcacaggagctcatccaccgcctggaggccgtgcag
cgcacgcgggaggctgaggagaagctggaggagcggttgaagcgcgtgcgcatggaggag
gaaggtgaggacggcgatccatcctcaggacccccagggccgtgccacaagctgcctccc
gcccccgcttggcaccacttcccaccccgctgtgtggacgtgggctgtgccgggctccgg
gacgcacacgaggagaaccctgagagcatcctggatgagcacgtgcagcgtgtgctgagg
acacctggccgccagtcacctgggcctggccaccgctccccggacagtgggcacgtggcc
aagatgccagtggcactggggggtgccgcctcggggcacgggaagcacgcacccaagtca
ggggcgaagctggatgcggccggcctgcaccaccaccggcacatccaccaccacgtccac
cacagcacagcccggcccaaggagcaggtggaggccgaggccgcccgcagggcccagagc
agcttcgcctggggcccggaaccgcacagccatggggcaaagtcccgaggctactcagag
aatgtgggcgctgcccccaacaccagtgatggcctggcccacagtgggaaggcgggcatg
gcatgcaaaagaaatgtcaagaaggccgagtcgggaaagagcgccagcaccgaggtgcca
ggcgcctcggaggatgcggagaagaaccagaaaatcatgcagtggatcattgagggggaa
aaggagatcagcaggcaccgcaggaccggccacgggtcttcagggatgaggaagccacag
ccccatgagaactccagacccttgtcccttgagcgccccggggccgtgcacccctgggtc
ggccctcagctccggacctccgtgcagccctcccacctcttcatccaagaccccacgatg
ccaccccacccagctcccaaccccctaacccagctggaggaggcgcgccgacgtctggag
gaggaagaaaagagagccagccgggcaccctccaagcagaggtatgtgcaggaggttatg
cggcggggacgcgcctgcgtcaggccagcgtgcgcgccggtgctgcgcgtggtaccagcc
gtgtcggacatggagctctccgagacagagacaagatcgcagaggaaggcgggcggcggg
agtgcccagccgtgtgacagcatcgttgtggcgtactacttctgcggggaacccatcccc
taccgcaccctggtgaggggccgcgctgtcaccctgggccagttcaaagagctgctgacc
aaaaagggcagttacagatactacttcaagaaagtgagcgacgagtttgactgtggggtg
gtgtttgaggaggttcgagaggacgaggccgtcctgcccgtctttgaggagaagatcatc
ggcaaagtggagaaggtggactga

DBGET integrated database retrieval system