KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100589956
Entry
100589956         CDS       T03265                                 

Gene name
CDKN1B
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle01522  Endocrine resistance
nle04012  ErbB signaling pathway
nle04066  HIF-1 signaling pathway
nle04068  FoxO signaling pathway
nle04110  Cell cycle
nle04151  PI3K-Akt signaling pathway
nle04933  AGE-RAGE signaling pathway in diabetic complications
nle04934  Cushing syndrome
nle05162  Measles
nle05165  Human papillomavirus infection
nle05169  Epstein-Barr virus infection
nle05200  Pathways in cancer
nle05202  Transcriptional misregulation in cancer
nle05203  Viral carcinogenesis
nle05206  MicroRNAs in cancer
nle05215  Prostate cancer
nle05220  Chronic myeloid leukemia
nle05222  Small cell lung cancer
nle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100589956 (CDKN1B)
   04066 HIF-1 signaling pathway
    100589956 (CDKN1B)
   04068 FoxO signaling pathway
    100589956 (CDKN1B)
   04151 PI3K-Akt signaling pathway
    100589956 (CDKN1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100589956 (CDKN1B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100589956 (CDKN1B)
   05202 Transcriptional misregulation in cancer
    100589956 (CDKN1B)
   05206 MicroRNAs in cancer
    100589956 (CDKN1B)
   05203 Viral carcinogenesis
    100589956 (CDKN1B)
  09162 Cancer: specific types
   05226 Gastric cancer
    100589956 (CDKN1B)
   05220 Chronic myeloid leukemia
    100589956 (CDKN1B)
   05215 Prostate cancer
    100589956 (CDKN1B)
   05222 Small cell lung cancer
    100589956 (CDKN1B)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100589956 (CDKN1B)
   04934 Cushing syndrome
    100589956 (CDKN1B)
  09172 Infectious disease: viral
   05162 Measles
    100589956 (CDKN1B)
   05169 Epstein-Barr virus infection
    100589956 (CDKN1B)
   05165 Human papillomavirus infection
    100589956 (CDKN1B)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100589956 (CDKN1B)
SSDB
Motif
Pfam: CDI Multi-haem_cyto
Other DBs
NCBI-GeneID: 100589956
NCBI-ProteinID: XP_003265565
Ensembl: ENSNLEG00000003595
UniProt: G1QTS5
LinkDB
Position
23
AA seq 198 aa
MSNVRVSNGSPSLERRDARQAEHPKPSACRNLFGPVDHEELTRDLEKHCRDMEEASQRKW
NFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRLPKGACKVPAQESQDVSGSRPAAPLIG
APANSEDTHLVDPKTDPSDSQTGLAEQCAGIRKRPATDDSSTQNKRANRTEENVSDSSPN
AGSVEQTPKKPGLRRRQT
NT seq 597 nt   +upstreamnt  +downstreamnt
atgtcaaacgtgcgagtgtctaacgggagccctagcctggagcggagggatgccaggcag
gcggagcaccccaagccctcggcctgcaggaacctcttcggcccggtggaccacgaagag
ttaacccgggacttggagaagcactgcagagacatggaagaggcgagccagcgcaagtgg
aatttcgattttcagaatcacaagcccctagagggcaagtacgagtggcaagaggtggag
aagggcagcttgcccgagttctactacagacccccgcggctccccaaaggcgcctgcaag
gtgccggcgcaggagagccaggatgtcagcgggagccgcccggcggcgcctttaattggg
gctccggctaattctgaggacacgcatttggtagacccaaagactgatccgtcggacagc
cagacaggtttagcggagcagtgcgcaggaataaggaagcgacctgcaaccgacgattct
tctactcaaaacaaaagagccaacagaacagaagaaaatgtttcagacagttccccaaat
gccggttctgtggagcagacgcccaagaagcctggcctcagaagacgtcaaacgtaa

DBGET integrated database retrieval system