KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100590102Help
Entry
100590102         CDS       T03265                                 

Gene name
ERBB3
Definition
(RefSeq) erb-b2 receptor tyrosine kinase 3
  KO
K05084  receptor tyrosine-protein kinase erbB-3 [EC:2.7.10.1]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle01521  EGFR tyrosine kinase inhibitor resistance
nle04010  MAPK signaling pathway
nle04012  ErbB signaling pathway
nle04020  Calcium signaling pathway
nle04151  PI3K-Akt signaling pathway
nle05205  Proteoglycans in cancer
nle05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100590102 (ERBB3)
   04012 ErbB signaling pathway
    100590102 (ERBB3)
   04020 Calcium signaling pathway
    100590102 (ERBB3)
   04151 PI3K-Akt signaling pathway
    100590102 (ERBB3)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100590102 (ERBB3)
   05205 Proteoglycans in cancer
    100590102 (ERBB3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100590102 (ERBB3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nle01001]
    100590102 (ERBB3)
Enzymes [BR:nle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100590102 (ERBB3)
Protein kinases [BR:nle01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   100590102 (ERBB3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Recep_L_domain GF_recep_IV Furin-like Pkinase Kinase-like
Motif
Other DBs
NCBI-GeneID: 100590102
NCBI-ProteinID: XP_003252875
UniProt: G1S724
LinkDB All DBs
Position
11
AA seq 1342 aa AA seqDB search
MRANDALQVLGLLFSLARGSEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVM
GNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFIM
LNYNTNSSHALRQLRLTQLTEILSGGVYIEKNDKLCHMDTIDWRDIVRDRDAEIVVKDNG
RSCPPCHEVCKGRCWGPGPEDCQTLTKTICAPQCNGHCFGPNPNQCCHDECAGGCSGPQD
TDCFACRHFNDSGACVPRCPQPLVYNKLTFQLEPNPHTKYQYGGVCVASCPHNFVVDQTS
CVRACPPDKMEVDKNGLKMCEPCGGLCPKACEGTGSGSRFQTVDSSNIDGFVNCTKILGN
LDFLITGLNGDPWHKIPALDPEKLSVFRTVREITGYLNIQSWPPHMHNFSVFSNLTTIGG
RSLYNRGFSLLIMKNLNVTSLGFRSLKEISAGRIYISANRQLCYHHSLNWTKVLRGPTEE
RLDIKHNRPRRDCVAEGKVCDPLCSSGGCWGPGPGQCLSCRNYSRGGVCVTHCNFLNGEP
REFAHEAECFSCHPECQPMEGTATCNGSGSDTCAQCAHFRDGPHCVSSCPHGVLGAKGPI
YKYPDVQNECRPCHENCTQGCKGPELQDCLGQTLVLIGKTHLTMALTVIAGLVVIFMMLG
GTFLYWRGRRIQNKRAMRRYLERGESIEPLDPSEKANKVLARIFKETELRKLKVLGLGVF
GTVHKGVWIPEGESIKIPVCIKVIEDKSGRQSFQAVTDHMLAIGSLDHAHIVRLLGLCPG
SSLQLVTQYLPLGSLLDHVRQHRGALGPQLLLNWGVQIAKGMYYLEEHGMVHRNLAARNV
LLKSPSQVQVADFGVADLLPPDDKQLLYSEAKTPIKWMALESIHFGKYTHQSDVWSYGVT
VWELMTFGAEPYAGLRLAEVPDLLEKGERLAQPQICTIDVYMVMVKCWMIDENIRPTFKE
LANEFTRMARDPPRYLVIKRESGPGIAPGPEPHGLTNKKLEEVELEPELDLDLDLEAEDD
NLATTTLGSALSLPVGTLNRPRGSQSLLSPSSGYMPMNQGNLGESCQESAVSGSSERCPR
PVSLHPMPRGCLASESSEGHVTGSEAELQEKVSMCRSRSRSRSPRPHGDSAYHSQRHSLL
TPVTPLSPPGLEEEDVNGYVMPDTHLKGTPSSREGTLSSVGLSSVLGTEEEDEDEEYEYM
NRRRRHSPPHPPRPGSLEELGYEYMDVGSDLSASLGSTQSCPLHPVPIMPTAGTTADEDY
EYMNRQRGGGGPGGDYAAMGACPASEQGYEEMRAFQGPGHQAPHVHYARLKTLRSLEATD
SAFDNPDYWHSRLFPKANAQRT
NT seq 4029 nt NT seq  +upstreamnt  +downstreamnt
atgagggcgaacgacgctctgcaggtgctgggcttgcttttcagcctggcccggggctcc
gaggtgggcaactctcaggcagtgtgtcctgggactctgaatggcctgagtgtgaccggc
gatgctgagaaccaataccagacactgtacaagctctacgagaggtgtgaggtggtgatg
gggaacctcgagattgtgctcacgggacacaatgccgacctctccttcctgcagtggatt
cgagaagtgacaggctatgtcctcgtggccatgaatgaattctctactctaccattgccc
aacctccgcgtggtgcgagggacccaggtctacgacgggaagtttgccatcttcatcatg
ttgaactataacaccaactccagccacgcactgcgccagctccgcttgactcagctcacc
gagattctgtcagggggtgtttatattgagaagaacgataagctttgtcacatggacaca
attgactggagggacatcgtgagggaccgagatgctgagatagtggtgaaggacaatggc
agaagctgtcccccctgtcatgaggtttgcaaggggcgatgctggggtcctggaccagaa
gactgccagacattgaccaagaccatctgtgctcctcagtgtaatggtcactgctttggg
cccaaccccaaccagtgctgccatgatgagtgtgctgggggctgctcaggccctcaggac
acagactgctttgcctgccggcacttcaatgacagtggagcctgtgtacctcgctgtcca
cagcctctcgtctacaacaagctaactttccagctggaacccaatccccacaccaagtat
cagtatggaggagtttgtgtagccagctgtccccataactttgtggtggatcaaacatcc
tgtgtcagggcctgtcctcctgacaagatggaagtagataaaaatgggctcaagatgtgt
gagccttgtgggggactatgtcccaaagcctgtgaggggacaggctctgggagccgcttc
cagactgtggactcgagcaacatcgatggatttgtgaactgcaccaagatcctgggcaac
ctggactttctgatcaccggcctcaatggagacccctggcacaagatccctgccctggac
ccagagaagctcagtgtcttccggacagtacgggagatcacaggttacctgaacatccag
tcctggccgccccacatgcacaacttcagtgttttttccaacttgacaaccattggaggc
agaagcctctacaaccggggcttctcattgttgatcatgaagaatttgaatgtcacatct
ctgggcttccgatccctgaaggaaattagtgctgggcgtatctatataagtgccaatagg
cagctctgctaccaccactctttgaactggaccaaggtgcttcgggggcctacagaagag
cgactagacatcaagcataatcggccacgcagagattgcgtggcagagggcaaagtgtgt
gacccactgtgctcctctgggggatgctggggcccgggccctggtcagtgcttgtcctgt
cgaaactatagccgaggaggtgtctgtgtgacccactgcaactttctgaatggggagcct
cgagaatttgcccatgaggccgaatgcttctcctgccacccggaatgccaacccatggag
ggcactgccacatgcaatggctcgggctctgatacttgtgctcaatgtgcccattttcga
gatgggccccactgtgtgagcagctgccctcatggagtcctaggtgccaagggcccaatc
tacaagtacccagatgttcagaatgaatgtcggccctgccacgagaactgcacccagggg
tgtaaaggaccagagcttcaagactgtttaggacaaacactggtgctgatcggcaaaacc
catctgacaatggctttgacagtgatagcaggattggtagtgattttcatgatgctgggc
ggcacttttctctattggcgtgggcgccggattcagaataaaagggctatgaggcgatac
ttggaacggggtgagagcatagagcctctggaccccagtgagaaggctaacaaagtcttg
gccagaatcttcaaagagacagagctaaggaagcttaaagtgcttggcttaggtgtcttt
ggaactgtgcacaaaggagtgtggatccctgagggtgaatcaatcaagattccagtctgc
attaaagtcattgaggacaagagtggacggcagagttttcaagctgtgacagatcatatg
ctggccattggcagcctggaccatgcccacattgtacggctgctgggactatgcccaggg
tcatctctgcagcttgtcactcaatacttgcctctgggttctctgctggatcatgtgaga
caacaccggggggcactggggccacagctgctgctcaactggggagtacaaattgccaag
ggaatgtactaccttgaggaacatggtatggtgcatagaaacctggctgcccgaaacgtg
ctacttaagtcacccagtcaggttcaggtggcagattttggtgtggctgacctgctgcct
cctgatgataagcagctgctatacagtgaggccaagactccaattaagtggatggccctt
gagagtatccactttgggaaatacacacaccagagtgatgtctggagctatggtgtgaca
gtttgggagctgatgaccttcggggcagagccctatgcaggactgcgattagctgaagta
ccagacctgctagagaagggggagcggttggcacagccccagatctgcacaattgatgtc
tacatggtgatggtcaagtgttggatgattgatgagaacattcgcccgacctttaaagaa
ctagccaatgagttcaccaggatggcccgagacccaccacggtatctggtcataaagaga
gagagtgggcctggaatagcccctgggccagagcctcatggtctgacaaacaagaagcta
gaggaagtagagctggagccagaactagacctagacctagacttggaagcagaggacgac
aacctggcaaccaccacactgggctccgccctcagcctaccagttggaacacttaatcgg
ccacgtgggagccagagccttttaagtccatcatctggatacatgcccatgaaccagggt
aatcttggggagtcttgccaggagtctgcagtttctgggagcagtgaacggtgcccccgt
ccagtctctctacatccaatgccacggggatgcctggcatcagagtcatcagagggccat
gtaacaggctctgaggctgagctccaggagaaagtgtcaatgtgtaggagccggagcagg
agccggagcccacggccacacggagatagcgcctaccattcccagcgccacagtctgctt
actcctgttaccccactctccccaccagggttagaggaagaggatgtcaacggttatgtc
atgccagatacacacctcaaaggtactccctcctcccgggaaggcaccctttcttcagtg
ggtctcagttctgtcctgggtactgaagaagaagatgaagatgaggagtatgaatacatg
aaccggaggagaaggcacagtccacctcatccgcctaggccaggttcccttgaggagctg
ggttatgagtacatggatgtggggtcagacctcagtgcctctctgggcagcacacagagt
tgcccactccaccctgtaccaatcatgcccactgctggcacaactgcagatgaagactat
gaatatatgaatcggcaacgaggtggaggtggtcctgggggtgattatgcagccatgggg
gcctgcccagcatctgagcaagggtatgaagagatgagagcttttcaggggcctggacat
caggccccccatgtccattatgcccgcctaaaaactctacgtagcttagaggctacagac
tctgcctttgataaccctgattactggcatagcaggcttttccccaaggctaatgcccag
agaacgtaa

DBGET integrated database retrieval system