KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100590310Help
Entry
100590310         CDS       T03265                                 

Gene name
MGAM
Definition
(RefSeq) maltase-glucoamylase
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle00052  Galactose metabolism
nle00500  Starch and sucrose metabolism
nle01100  Metabolic pathways
nle04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:nle00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100590310 (MGAM)
   00500 Starch and sucrose metabolism
    100590310 (MGAM)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100590310 (MGAM)
Enzymes [BR:nle01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     100590310 (MGAM)
    3.2.1.20  alpha-glucosidase
     100590310 (MGAM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 100590310
NCBI-ProteinID: XP_003270883
LinkDB All DBs
Position
13
AA seq 1873 aa AA seqDB search
MARKKLKKFTTLEIVLSVLLLVLFIISIVLIVLLAKESLKSTAPDPGTTGTPDPGTTGST
HPRTTGPLDPGTTGTPDPGTTGSTHPRTTGPLDPGTTATTPVSAECPVVNELERINCIPD
QPPTKATCDQRGCCWNPQGAVSVPWCYYSKNHSYHMEGDLVNTNAGFTARLKNLPSSPVF
GSNVDNVLLTAEYQTSNRFHFKLTDQTNNRFEVPHEHVQSFSGNAASSLTYQVEISREPF
SIKVTRRSNNRVLFDSSIGPLLFADQFLQLSTRLPSANVYGLGEHVHQQYRHDMNWKTWP
IFNRDTTPNGNGTNLYGAQTFFLCLEDASGLSFGVFLMNSNAMEVVLQPAPAITYRTTGG
ILDFYVFLGNTPEQVVQEYLELIGRPALPSYWALGFHLSRYEYGTLDNMREVVERNRAAQ
LPYDVQHADIDYMDERRDFTYDPVDFKGFPAFVNELHNNGQKLVIIVDPAISNNSSSSKP
YGPYDRGSDMKIWVNSSDGVTPLIGEVWPGQTVFPDYTNPNCAVWWTKEFELFHNQVEFD
GIWIDMNEVSNFVDGSVSGCSTNNLNNPPFTPRILDGYLFCKTLCMDAVQHWGKQYDVHN
LYGYSMAVATAEAAKTVFPNKRSFILTRSTFAGSGKFAAHWLGDNTATWDDLRWSIPGVL
EFNLFGIPMVGPDICGFALDAPEELCRRWMQLGAFYPFSRNHNGQGYKDQDPASFGADSL
LLNSSRHYLNIRYTLLPYLYTLFFRAHSRGDTVARPLLHEFYEDNSTWDVHQQFLWGPGL
LITPVLDEGAEKVMAYVPDAIWYDYETGSQVRWRKQKVEMELPGDKIGLHLRGGYIFPTQ
QPNTTTLASRKNPLGLIIALDENKEAKGELFWDDGETKDTVANKVYLLCEFSVTQNRLEV
NISQSTYKDPNNLAFNEIKILGTEEPSNVTVKHNGVPSQTSPTVTYDSNLKVAVITDIDL
LLGEAYTVEWSIKIRDEEKIDCYPDENGASAENCAARGCIWEASNSSGVPFCYFVNDLYS
VSDVQYNSHGATADISLKSSVYANAFPSTPVNPLRLDVTYHKNEMLQFKIYDPNNNRYEV
PVPLSIPSVPSSTPEGQLYDVLIKKNPFGIEIRRKSTGTVIWDSQLLGFTFNDMFIRIST
RLPSKYLYGFGETEHTSYRRDLEWHTWGMFSRDQPPGYKKNSYGVHPYYMGLEEDGSAHG
VLLLNSNAMDVTFQPLPALTYRTTGGVLDFYVFLGPTPELVTQQYTELIGRPVMVPYWSL
GFQLCRYGYQNDSEIASLYDEMVAAQIPYDVQYSDIDYMERQLDFTLSPKFAGFPALINR
MKADGMRVILILDPAISGNETQPYPAFTRGIEDDVFIKYPNDGDIVWGKVWPDFPDVVVN
GSLDWDSQVELYRAYVAFPDFFRNSTAKWWKREIEELYNNPQNPERSLKFDGMWIDMNEP
SSFVNGAVSPGCREASLNHPPYMPYLESRDRGLSSKTLCMESQQILPDGSPVQHYNVHNL
YGWSQTRPTYEAVQEVTGQRGVVITRSTFPSSGRWAGHWLGDNTAAWDQLKKSIIGMMEF
SLFGISYTGADICGFFQDAEYEMCVRWMQLGAFYPFSRNHNTIGTRRQDPVSWDAAFVNI
SRTVLQTRYTLLPYLYTLMHKAHTEGVTVVRPLLHEFVSDQLTWDIDSQFLLGPAFLVSP
VLELNARNVTAYFPRARWYDYYTGVDINARGEWKTLPAPLDHINLHVRGGYILPWQEPAL
NTHLSRQKFMGFKIALDDEGTAEGWLFWDDGQSIDTYGKGLYYLANFSASQNTMQSYIIF
NNYITGTNPLKLGYIEIWGVGSVPITSVSISVSSMVITPSFNNDPTTQVLSIDVTDRNIS
LHNFNSLTWRSTP
NT seq 5622 nt NT seq  +upstreamnt  +downstreamnt
atggcaagaaagaagctgaaaaaatttactactttggagattgtgctcagtgttcttctg
cttgtgttgtttatcatcagtattgttctaattgtgcttttagccaaagagtcactgaaa
tcaacagccccagatcccgggacaactggtaccccagatcctggaacaactggttccaca
catcctaggacaactggtcccctagatcccggaacaactggtaccccagatcctggaaca
actggttccacacatcctaggacaactggtcccctagatcccggaacaactgctaccact
cctgtttctgctgaatgtccagtggtaaatgaattggaacgaattaattgcatccctgac
cagccaccaacaaaggccacatgtgaccaacgtggctgttgctggaatccccagggagct
gtaagtgttccctggtgctactattccaagaatcatagctaccacatggagggcgacctt
gtaaacacaaatgcaggattcacagcccggttgaaaaatctgccttcttcacccgtgttc
ggaagcaatgttgacaatgttcttctcacagcagagtatcagacatctaatcgtttccac
tttaagttgaccgaccaaaccaataacaggtttgaagtgccccacgaacacgtgcagtcc
ttcagtggaaatgctgcttcttctttgacctaccaagttgaaatctccagagagccattt
agcatcaaagtgaccagaagaagcaacaatcgtgttttgtttgactcgagcattgggccc
ctactgtttgctgaccagttcttgcagctctccactcgactgcctagcgctaacgtgtat
ggcctgggagagcatgtgcaccagcagtaccggcatgatatgaattggaagacttggccc
atatttaacagggacacaactcccaatggaaacggaactaatttgtatggtgcgcagaca
ttcttcttgtgccttgaagacgctagtggattgtcctttggagtgtttctgatgaacagc
aatgccatggaggttgtccttcagcctgcgccagccatcacttaccgcaccactgggggc
attctcgacttctatgtgttcttgggaaacactccagagcaagttgttcaagaatatcta
gagcttattgggcggccagcccttccctcctactgggcgcttggatttcacctcagtcgt
tatgaatatggaaccttagacaacatgagggaagtcgtggagagaaatcgcgcagcacag
ctcccttatgatgttcagcatgctgatattgattatatggatgagagaagggacttcact
tatgatccagtggattttaaaggcttccctgcatttgtcaacgagttacacaataatgga
cagaagcttgtcatcattgtggatccagccatctccaacaactcttcctcaagtaaacct
tatggcccatatgacaggggttcagatatgaagatatgggtgaatagttcagatggagtg
actccactcattggggaggtctggcctggacaaactgtgtttcctgattataccaatccc
aactgtgctgtttggtggacaaaggaatttgagctttttcacaatcaagtggagtttgat
ggaatctggattgatatgaatgaagtctccaactttgttgatggttcggtctcaggatgt
tccacaaacaacctaaataatcccccattcactcccagaatcctggatgggtatctgttc
tgcaagactctctgtatggatgcagtgcagcactggggcaagcaatatgacgttcacaat
ctgtatggctactccatggcggtcgctacagcagaagctgccaagactgtgttccctaat
aagagaagcttcattctgacccgttctacctttgcgggctctggcaagtttgcagcacat
tggttaggagacaacactgccacctgggacgacctgcgatggtccatccctggcgtgctt
gagttcaaccttttcggcatcccaatggtgggtcctgacatatgtggctttgccttggat
gcccctgaggagctctgtaggcggtggatgcagttgggtgcattttatccattttctaga
aatcacaatggccaaggctacaaggaccaggatcctgcctcctttggagctgactccctg
ctgttgaattcctccaggcactaccttaacatccgctatactctattgccctacctatac
accctcttctttcgtgctcacagccgaggggacacggtggccaggccccttttgcatgag
ttctacgaggacaacagcacttgggatgtgcaccaacagttcttatgggggcctggcctc
ctcatcactccagttctggatgaaggtgcagagaaagtgatggcatatgtgcctgatgct
atctggtatgactacgagactgggagccaagtgaggtggaggaagcaaaaagtcgagatg
gaacttcctggagacaaaattggacttcaccttcgaggaggctacatcttccccacacag
cagccaaatacaaccactctggccagtcgaaagaaccctcttggtcttatcattgcccta
gatgagaacaaagaagcaaaaggagaacttttctgggatgatggggaaacgaaggatact
gtggccaataaagtgtatcttttatgtgagttttctgtcactcaaaaccgcttggaggtg
aatatttcacaatcaacctataaggaccccaataatttagcattcaatgaaattaaaatt
cttgggacggaggaacctagcaatgttacagtgaagcacaatggtgtcccaagtcagact
tctcctacagtcacttatgattctaacctgaaggttgccgttatcacagatatcgatctt
ctcctgggagaagcatacacagtggagtggagcataaagataagggatgaagaaaaaata
gactgttaccctgatgagaatggtgcttctgcagaaaactgcgctgcccgtggctgtatc
tgggaggcatccaattcttctggagtccctttttgctattttgtcaatgatctatactct
gtcagtgatgttcagtataattcccatggggccacagctgacatctccttaaagtcttct
gtttatgccaatgccttcccctccacacccgtgaacccccttcgcctggatgtcacttac
cataagaatgaaatgctgcagttcaagatttatgatcccaacaacaatcggtatgaagtt
ccagtccctctgagcatacccagcgtgccatccagcacccctgagggtcaactctatgat
gtcctcattaagaagaatccatttgggattgaaattcgccggaagagtacaggcactgta
atttgggactctcagctccttggcttcaccttcaatgacatgtttatccgcatctccacc
cgcctcccctccaagtacctctacggctttggggaaactgagcacacgtcctataggaga
gacctggagtggcacacttgggggatgttctcccgagaccagcccccagggtacaagaag
aattcctatggtgtccacccctactacatggggctggaggaggacggcagtgcccatgga
gtgctcctgctgaacagcaatgccatggatgtgacgttccagcccctgcctgccttgaca
taccgtaccacagggggagttctggacttttatgtgttcttggggccaactccagagctt
gtcacccagcagtacactgagttgattggccggcctgtgatggtaccttactggtctttg
gggttccagctgtgtcgctatggctaccagaacgactctgagatcgccagcttgtatgat
gagatggtggctgcccagatcccttatgacgtgcagtactcagacatcgactacatggag
cggcagctggacttcaccctcagccccaagtttgctgggtttccagcactgatcaatcgc
atgaaggctgatgggatgcgggtcatcctcattctggatccagccatttctggcaatgag
acacagccctatcctgccttcactcggggcatagaggatgacgtcttcatcaaataccca
aatgatggagacattgtctggggaaaggtctggcctgattttcctgatgttgttgtgaat
gggtctctagactgggacagtcaagtggagctgtatcgagcttatgtggccttcccagac
tttttccgtaattcaactgccaagtggtggaagagggaaatagaagaactatacaacaat
ccacagaatccagagaggagcttgaagtttgatggcatgtggattgatatgaacgaacca
tcaagctttgtgaatggggcagtttctccaggctgcagggaagcctctctgaaccaccct
ccctacatgccatatttggagtccagggacaggggcctgagcagcaagaccctgtgcatg
gagagtcagcagatcctcccagacggctccccagtgcagcactacaacgtgcacaacctg
tacgggtggtcccagaccagacccacatacgaagccgtgcaggaggtgacgggacagcga
ggggtcgtcatcacccgctccacatttccctcttctggccgctgggcaggacattggctg
ggagacaacacggctgcgtgggatcagctgaagaaatctatcattggcatgatggagttc
agcctctttggcatatcctatacgggagcagatatctgtgggttctttcaagacgctgaa
tatgagatgtgtgttcgctggatgcagctgggggccttctaccccttctcaagaaaccac
aacaccattgggaccaggagacaagaccctgtgtcctgggatgctgcttttgtgaacatt
tccagaactgtcctgcagaccagatacaccctgttgccatatctgtataccttgatgcat
aaggcccacacggagggcgtcactgttgtgcggcctctgctccatgagtttgtgtcagat
cagctgacatgggacatagacagtcagttcctgctgggcccagccttcctggtcagccct
gtcctggagctgaatgccagaaatgtcactgcatatttccctagagcccgctggtacgat
tactacacgggtgtggatattaatgcaagaggagagtggaagacattgccagcccccctt
gaccacattaatcttcatgtccgtgggggctacatcctgccctggcaagagcctgcactg
aacacccacttaagccgccagaaattcatgggcttcaaaattgccttggatgatgaggga
actgctgagggctggctcttctgggatgatgggcaaagcattgatacctatgggaaagga
ctctattacttggccaacttttctgccagccagaatacgatgcaaagctatataattttc
aacaattatatcactggtacaaatcctttgaaactgggctacattgaaatctggggagtg
ggcagtgtccccattaccagtgtcagcatctctgtgagcagcatggtcataacaccctcc
ttcaacaatgaccccacgacacaggtattaagcatcgatgtgactgacaggaacatcagc
ctacataattttaattcattgacttggagaagcactccgtga

DBGET integrated database retrieval system