KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100590939
Entry
100590939         CDS       T03265                                 

Gene name
PRKCB
Definition
(RefSeq) protein kinase C beta type isoform X2
  KO
K19662  classical protein kinase C beta type [EC:2.7.11.13]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle01521  EGFR tyrosine kinase inhibitor resistance
nle04010  MAPK signaling pathway
nle04012  ErbB signaling pathway
nle04014  Ras signaling pathway
nle04015  Rap1 signaling pathway
nle04020  Calcium signaling pathway
nle04062  Chemokine signaling pathway
nle04064  NF-kappa B signaling pathway
nle04066  HIF-1 signaling pathway
nle04070  Phosphatidylinositol signaling system
nle04071  Sphingolipid signaling pathway
nle04150  mTOR signaling pathway
nle04270  Vascular smooth muscle contraction
nle04310  Wnt signaling pathway
nle04370  VEGF signaling pathway
nle04510  Focal adhesion
nle04540  Gap junction
nle04613  Neutrophil extracellular trap formation
nle04650  Natural killer cell mediated cytotoxicity
nle04662  B cell receptor signaling pathway
nle04666  Fc gamma R-mediated phagocytosis
nle04670  Leukocyte transendothelial migration
nle04713  Circadian entrainment
nle04720  Long-term potentiation
nle04723  Retrograde endocannabinoid signaling
nle04724  Glutamatergic synapse
nle04725  Cholinergic synapse
nle04726  Serotonergic synapse
nle04727  GABAergic synapse
nle04728  Dopaminergic synapse
nle04730  Long-term depression
nle04750  Inflammatory mediator regulation of TRP channels
nle04911  Insulin secretion
nle04912  GnRH signaling pathway
nle04916  Melanogenesis
nle04918  Thyroid hormone synthesis
nle04919  Thyroid hormone signaling pathway
nle04921  Oxytocin signaling pathway
nle04925  Aldosterone synthesis and secretion
nle04928  Parathyroid hormone synthesis, secretion and action
nle04929  GnRH secretion
nle04931  Insulin resistance
nle04933  AGE-RAGE signaling pathway in diabetic complications
nle04935  Growth hormone synthesis, secretion and action
nle04960  Aldosterone-regulated sodium reabsorption
nle04961  Endocrine and other factor-regulated calcium reabsorption
nle04970  Salivary secretion
nle04971  Gastric acid secretion
nle04972  Pancreatic secretion
nle04973  Carbohydrate digestion and absorption
nle05017  Spinocerebellar ataxia
nle05022  Pathways of neurodegeneration - multiple diseases
nle05031  Amphetamine addiction
nle05032  Morphine addiction
nle05140  Leishmaniasis
nle05143  African trypanosomiasis
nle05146  Amoebiasis
nle05161  Hepatitis B
nle05163  Human cytomegalovirus infection
nle05164  Influenza A
nle05170  Human immunodeficiency virus 1 infection
nle05171  Coronavirus disease - COVID-19
nle05200  Pathways in cancer
nle05205  Proteoglycans in cancer
nle05206  MicroRNAs in cancer
nle05214  Glioma
nle05223  Non-small cell lung cancer
nle05225  Hepatocellular carcinoma
nle05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100590939 (PRKCB)
   04012 ErbB signaling pathway
    100590939 (PRKCB)
   04014 Ras signaling pathway
    100590939 (PRKCB)
   04015 Rap1 signaling pathway
    100590939 (PRKCB)
   04310 Wnt signaling pathway
    100590939 (PRKCB)
   04370 VEGF signaling pathway
    100590939 (PRKCB)
   04064 NF-kappa B signaling pathway
    100590939 (PRKCB)
   04066 HIF-1 signaling pathway
    100590939 (PRKCB)
   04020 Calcium signaling pathway
    100590939 (PRKCB)
   04070 Phosphatidylinositol signaling system
    100590939 (PRKCB)
   04071 Sphingolipid signaling pathway
    100590939 (PRKCB)
   04150 mTOR signaling pathway
    100590939 (PRKCB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100590939 (PRKCB)
   04540 Gap junction
    100590939 (PRKCB)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100590939 (PRKCB)
   04650 Natural killer cell mediated cytotoxicity
    100590939 (PRKCB)
   04662 B cell receptor signaling pathway
    100590939 (PRKCB)
   04666 Fc gamma R-mediated phagocytosis
    100590939 (PRKCB)
   04670 Leukocyte transendothelial migration
    100590939 (PRKCB)
   04062 Chemokine signaling pathway
    100590939 (PRKCB)
  09152 Endocrine system
   04911 Insulin secretion
    100590939 (PRKCB)
   04929 GnRH secretion
    100590939 (PRKCB)
   04912 GnRH signaling pathway
    100590939 (PRKCB)
   04921 Oxytocin signaling pathway
    100590939 (PRKCB)
   04935 Growth hormone synthesis, secretion and action
    100590939 (PRKCB)
   04918 Thyroid hormone synthesis
    100590939 (PRKCB)
   04919 Thyroid hormone signaling pathway
    100590939 (PRKCB)
   04928 Parathyroid hormone synthesis, secretion and action
    100590939 (PRKCB)
   04916 Melanogenesis
    100590939 (PRKCB)
   04925 Aldosterone synthesis and secretion
    100590939 (PRKCB)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100590939 (PRKCB)
  09154 Digestive system
   04970 Salivary secretion
    100590939 (PRKCB)
   04971 Gastric acid secretion
    100590939 (PRKCB)
   04972 Pancreatic secretion
    100590939 (PRKCB)
   04973 Carbohydrate digestion and absorption
    100590939 (PRKCB)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100590939 (PRKCB)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100590939 (PRKCB)
  09156 Nervous system
   04724 Glutamatergic synapse
    100590939 (PRKCB)
   04727 GABAergic synapse
    100590939 (PRKCB)
   04725 Cholinergic synapse
    100590939 (PRKCB)
   04728 Dopaminergic synapse
    100590939 (PRKCB)
   04726 Serotonergic synapse
    100590939 (PRKCB)
   04720 Long-term potentiation
    100590939 (PRKCB)
   04730 Long-term depression
    100590939 (PRKCB)
   04723 Retrograde endocannabinoid signaling
    100590939 (PRKCB)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100590939 (PRKCB)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100590939 (PRKCB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100590939 (PRKCB)
   05206 MicroRNAs in cancer
    100590939 (PRKCB)
   05205 Proteoglycans in cancer
    100590939 (PRKCB)
   05231 Choline metabolism in cancer
    100590939 (PRKCB)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100590939 (PRKCB)
   05214 Glioma
    100590939 (PRKCB)
   05223 Non-small cell lung cancer
    100590939 (PRKCB)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    100590939 (PRKCB)
   05022 Pathways of neurodegeneration - multiple diseases
    100590939 (PRKCB)
  09165 Substance dependence
   05031 Amphetamine addiction
    100590939 (PRKCB)
   05032 Morphine addiction
    100590939 (PRKCB)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100590939 (PRKCB)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100590939 (PRKCB)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100590939 (PRKCB)
   05161 Hepatitis B
    100590939 (PRKCB)
   05171 Coronavirus disease - COVID-19
    100590939 (PRKCB)
   05164 Influenza A
    100590939 (PRKCB)
   05163 Human cytomegalovirus infection
    100590939 (PRKCB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100590939 (PRKCB)
   05140 Leishmaniasis
    100590939 (PRKCB)
   05143 African trypanosomiasis
    100590939 (PRKCB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100590939 (PRKCB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nle01001]
    100590939 (PRKCB)
Enzymes [BR:nle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     100590939 (PRKCB)
Protein kinases [BR:nle01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   100590939 (PRKCB)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C C1_2 Kinase-like CEP76-C2 APH
Other DBs
NCBI-GeneID: 100590939
NCBI-ProteinID: XP_003261718
Ensembl: ENSNLEG00000011923
UniProt: G1RMP5
LinkDB
Position
2
AA seq 671 aa
MADPATGPPPSEGEESTVRFARKGALRQKNVHEVKNHKFTARFFKQPTFCSHCTDFIWGF
GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCDHCGS
LLYGLIHQGMKCDTCMMNVHKRCVMNVPSLCGTDHTERRGRIYIQAHIDRDVLIVLVRDA
KNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFRFQLKESDKDRRL
SVEIWDWDLTSRNDFMGSLSFGISELQKASVDGWFKLLSQEEGEYFNVPVPPEGSEANEE
LRQKFERAKISQGTKVPEEKTTNTVSKFDNNGNRDRMKLTDFNFLMVLGKGSFGKVMLSE
RKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVM
EYVNGGDLMYHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHI
KIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAP
FEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFF
RYIDWEKLERKEIQPPYKPKARDKRDTSNFDKEFTRQPVELTPTDKLFIMNLDQNEFAGF
SYTNPEFVINV
NT seq 2016 nt   +upstreamnt  +downstreamnt
atggctgacccggctacggggccgccgccgagcgagggcgaggagagcaccgtgcgcttc
gcccgcaaaggcgccctccggcagaagaacgtgcatgaggtcaagaaccacaaattcacc
gcccgcttcttcaagcagcccaccttctgcagccactgcaccgacttcatctggggcttc
gggaagcagggattccagtgccaagtttgctgctttgtggtgcacaagcggtgccatgaa
tttgtcacattctcctgccctggcgctgacaagggtccagcctctgatgacccccggagc
aaacacaagtttaagatccacacgtactccagccccacgttttgtgaccactgtgggtca
ctgctgtatggactcatccaccaggggatgaaatgtgacacctgcatgatgaatgtgcac
aagcgctgcgtgatgaacgttcccagcctgtgtggcacggaccacacggaacgccgcggc
cgcatctacatccaggcccacatcgacagggacgtcctcattgtcctcgtaagagatgct
aaaaaccttgtacctatggaccccaatggcctgtcagatccctacgtaaaactgaaactg
attcctgatcccaaaagtgagagcaaacagaagaccaaaaccatcaaatgctccctcaac
cccgagtggaacgagacatttagatttcagctgaaagaatcggacaaagacagaagactg
tcagtagagatttgggattgggatttgaccagcaggaatgacttcatgggatctttgtcc
tttgggatttctgaacttcagaaagccagtgttgatggctggtttaagttactgagccag
gaggaaggcgagtacttcaatgtgcctgtgccaccggaaggaagtgaggccaatgaagaa
ctgcggcagaaatttgagagggccaagatcagtcagggaaccaaggtcccggaagaaaag
acgaccaacactgtctccaaattcgacaacaatggcaacagagaccggatgaaactgacc
gattttaacttcctaatggtgctggggaaaggcagctttggcaaggtcatgctttcagaa
cgaaaaggcacagatgagctctatgctgtgaagatcctgaagaaggacgttgtgatccaa
gatgatgacgtggagtgcactatggtggagaagcgggtgctggccctgcccgggaagcca
cccttcctgacccagctccactcctgcttccagaccatggaccgcctgtactttgtgatg
gagtacgtgaatgggggcgacctcatgtatcacatccagcaagtcggccggttcaaggag
ccccatgctgtattttacgctgcggaaattgccatcggtctgttcttcttacagagtaag
ggcatcatttaccgtgacctaaaacttgacaacgtgatgctcgattctgaggggcacatc
aagattgctgattttggcatgtgtaaggaaaacatctgggatggggtgacaaccaagaca
ttctgtggcactccagactacatcgcccccgagataattgcttatcagccctatgggaag
tccgtggattggtgggcatttggagtcctgctgtatgaaatgttggctgggcaggcaccc
tttgaaggggaggatgaagatgaactcttccaatccatcatggaacacaatgtagcctat
cccaagtctatgtccaaggaagctgtggccatctgcaaagggctgatgaccaaacaccca
ggcaaacgtctgggttgtggacctgaaggcgaacgtgatatcaaagagcatgcatttttc
cggtatattgattgggagaaacttgaacgcaaagagatccagcccccatataagccaaaa
gctagagacaagagagacacctccaacttcgacaaagagttcaccagacagcctgtggaa
ctgacacccactgataaacttttcatcatgaacttggaccaaaatgaatttgctggcttc
tcttatactaacccagagtttgtcattaatgtgtag

KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100591651
Entry
100591651         CDS       T03265                                 

Gene name
PRKCA
Definition
(RefSeq) protein kinase C alpha type isoform X1
  KO
K02677  classical protein kinase C alpha type [EC:2.7.11.13]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle01521  EGFR tyrosine kinase inhibitor resistance
nle04010  MAPK signaling pathway
nle04012  ErbB signaling pathway
nle04014  Ras signaling pathway
nle04015  Rap1 signaling pathway
nle04020  Calcium signaling pathway
nle04066  HIF-1 signaling pathway
nle04070  Phosphatidylinositol signaling system
nle04071  Sphingolipid signaling pathway
nle04072  Phospholipase D signaling pathway
nle04150  mTOR signaling pathway
nle04151  PI3K-Akt signaling pathway
nle04261  Adrenergic signaling in cardiomyocytes
nle04270  Vascular smooth muscle contraction
nle04310  Wnt signaling pathway
nle04360  Axon guidance
nle04370  VEGF signaling pathway
nle04510  Focal adhesion
nle04540  Gap junction
nle04613  Neutrophil extracellular trap formation
nle04650  Natural killer cell mediated cytotoxicity
nle04664  Fc epsilon RI signaling pathway
nle04666  Fc gamma R-mediated phagocytosis
nle04670  Leukocyte transendothelial migration
nle04713  Circadian entrainment
nle04720  Long-term potentiation
nle04723  Retrograde endocannabinoid signaling
nle04724  Glutamatergic synapse
nle04725  Cholinergic synapse
nle04726  Serotonergic synapse
nle04727  GABAergic synapse
nle04728  Dopaminergic synapse
nle04730  Long-term depression
nle04750  Inflammatory mediator regulation of TRP channels
nle04911  Insulin secretion
nle04912  GnRH signaling pathway
nle04916  Melanogenesis
nle04918  Thyroid hormone synthesis
nle04919  Thyroid hormone signaling pathway
nle04921  Oxytocin signaling pathway
nle04925  Aldosterone synthesis and secretion
nle04926  Relaxin signaling pathway
nle04928  Parathyroid hormone synthesis, secretion and action
nle04929  GnRH secretion
nle04933  AGE-RAGE signaling pathway in diabetic complications
nle04935  Growth hormone synthesis, secretion and action
nle04960  Aldosterone-regulated sodium reabsorption
nle04961  Endocrine and other factor-regulated calcium reabsorption
nle04970  Salivary secretion
nle04971  Gastric acid secretion
nle04972  Pancreatic secretion
nle05017  Spinocerebellar ataxia
nle05022  Pathways of neurodegeneration - multiple diseases
nle05031  Amphetamine addiction
nle05032  Morphine addiction
nle05143  African trypanosomiasis
nle05146  Amoebiasis
nle05161  Hepatitis B
nle05163  Human cytomegalovirus infection
nle05164  Influenza A
nle05170  Human immunodeficiency virus 1 infection
nle05171  Coronavirus disease - COVID-19
nle05200  Pathways in cancer
nle05205  Proteoglycans in cancer
nle05206  MicroRNAs in cancer
nle05214  Glioma
nle05223  Non-small cell lung cancer
nle05225  Hepatocellular carcinoma
nle05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100591651 (PRKCA)
   04012 ErbB signaling pathway
    100591651 (PRKCA)
   04014 Ras signaling pathway
    100591651 (PRKCA)
   04015 Rap1 signaling pathway
    100591651 (PRKCA)
   04310 Wnt signaling pathway
    100591651 (PRKCA)
   04370 VEGF signaling pathway
    100591651 (PRKCA)
   04066 HIF-1 signaling pathway
    100591651 (PRKCA)
   04020 Calcium signaling pathway
    100591651 (PRKCA)
   04070 Phosphatidylinositol signaling system
    100591651 (PRKCA)
   04072 Phospholipase D signaling pathway
    100591651 (PRKCA)
   04071 Sphingolipid signaling pathway
    100591651 (PRKCA)
   04151 PI3K-Akt signaling pathway
    100591651 (PRKCA)
   04150 mTOR signaling pathway
    100591651 (PRKCA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100591651 (PRKCA)
   04540 Gap junction
    100591651 (PRKCA)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100591651 (PRKCA)
   04650 Natural killer cell mediated cytotoxicity
    100591651 (PRKCA)
   04664 Fc epsilon RI signaling pathway
    100591651 (PRKCA)
   04666 Fc gamma R-mediated phagocytosis
    100591651 (PRKCA)
   04670 Leukocyte transendothelial migration
    100591651 (PRKCA)
  09152 Endocrine system
   04911 Insulin secretion
    100591651 (PRKCA)
   04929 GnRH secretion
    100591651 (PRKCA)
   04912 GnRH signaling pathway
    100591651 (PRKCA)
   04921 Oxytocin signaling pathway
    100591651 (PRKCA)
   04926 Relaxin signaling pathway
    100591651 (PRKCA)
   04935 Growth hormone synthesis, secretion and action
    100591651 (PRKCA)
   04918 Thyroid hormone synthesis
    100591651 (PRKCA)
   04919 Thyroid hormone signaling pathway
    100591651 (PRKCA)
   04928 Parathyroid hormone synthesis, secretion and action
    100591651 (PRKCA)
   04916 Melanogenesis
    100591651 (PRKCA)
   04925 Aldosterone synthesis and secretion
    100591651 (PRKCA)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100591651 (PRKCA)
   04270 Vascular smooth muscle contraction
    100591651 (PRKCA)
  09154 Digestive system
   04970 Salivary secretion
    100591651 (PRKCA)
   04971 Gastric acid secretion
    100591651 (PRKCA)
   04972 Pancreatic secretion
    100591651 (PRKCA)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100591651 (PRKCA)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100591651 (PRKCA)
  09156 Nervous system
   04724 Glutamatergic synapse
    100591651 (PRKCA)
   04727 GABAergic synapse
    100591651 (PRKCA)
   04725 Cholinergic synapse
    100591651 (PRKCA)
   04728 Dopaminergic synapse
    100591651 (PRKCA)
   04726 Serotonergic synapse
    100591651 (PRKCA)
   04720 Long-term potentiation
    100591651 (PRKCA)
   04730 Long-term depression
    100591651 (PRKCA)
   04723 Retrograde endocannabinoid signaling
    100591651 (PRKCA)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100591651 (PRKCA)
  09158 Development and regeneration
   04360 Axon guidance
    100591651 (PRKCA)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100591651 (PRKCA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100591651 (PRKCA)
   05206 MicroRNAs in cancer
    100591651 (PRKCA)
   05205 Proteoglycans in cancer
    100591651 (PRKCA)
   05231 Choline metabolism in cancer
    100591651 (PRKCA)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100591651 (PRKCA)
   05214 Glioma
    100591651 (PRKCA)
   05223 Non-small cell lung cancer
    100591651 (PRKCA)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    100591651 (PRKCA)
   05022 Pathways of neurodegeneration - multiple diseases
    100591651 (PRKCA)
  09165 Substance dependence
   05031 Amphetamine addiction
    100591651 (PRKCA)
   05032 Morphine addiction
    100591651 (PRKCA)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100591651 (PRKCA)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100591651 (PRKCA)
   05161 Hepatitis B
    100591651 (PRKCA)
   05171 Coronavirus disease - COVID-19
    100591651 (PRKCA)
   05164 Influenza A
    100591651 (PRKCA)
   05163 Human cytomegalovirus infection
    100591651 (PRKCA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100591651 (PRKCA)
   05143 African trypanosomiasis
    100591651 (PRKCA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100591651 (PRKCA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nle01001]
    100591651 (PRKCA)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nle04131]
    100591651 (PRKCA)
Enzymes [BR:nle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     100591651 (PRKCA)
Protein kinases [BR:nle01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   100591651 (PRKCA)
Membrane trafficking [BR:nle04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    100591651 (PRKCA)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C C1_2 APH
Other DBs
NCBI-GeneID: 100591651
NCBI-ProteinID: XP_030684345
Ensembl: ENSNLEG00000000267
LinkDB
Position
14
AA seq 672 aa
MADVFPGNDSTASQDVANRFARKGALRQKNVHEVKDHKFIARFFKQPTFCSHCTDFIWGF
GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGS
LLYGLIHQGMKCDTCDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAEVADEKLHVTVRDA
KNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRL
SVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEGDEEGNME
LRQKFEKAKLGPAGNKVISPSEDRKQPSNNLDRVKLTDFNFLMVLGKGSFGKVMLADRKG
TEELYAIKILKKDVVIQDDDVECTMVEKRVLALLDKPPFLTQLHSCFQTVDRLYFVMEYV
NGGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIA
DFGMCKEHMMDGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDG
EDEDELFQSIMEHNVSYPKSLSKEAVSICKGLMTKHPAKRLGCGPEGERDVREHAFFRRI
DWEKLENREIQPPFKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVN
PQFVHPILQSAV
NT seq 2019 nt   +upstreamnt  +downstreamnt
atggctgacgttttcccgggcaacgactccacggcgtctcaggacgtggccaaccgcttc
gcccgcaaaggggcgctgaggcagaagaacgtgcacgaggtgaaggaccacaaattcatc
gcgcgcttcttcaagcagcccaccttctgcagccactgcactgacttcatctgggggttt
gggaaacaaggcttccagtgccaagtttgctgttttgtggtccacaagaggtgccatgaa
tttgttactttttcttgtccgggtgcggataagggacctgacactgatgaccccaggagc
aagcacaagttcaaaatccacacttacggaagccccaccttctgcgatcactgtgggtca
ctgctttatggacttatccatcaaggaatgaaatgtgacacctgcgatatgaacgttcac
aagcaatgcgtcatcaatgtccccagcctctgcggaatggatcacacagagaagaggggg
cggatttacctaaaggctgaggttgctgacgaaaagctccatgtcacagtacgagatgca
aaaaatctaatacctatggatccaaacgggctttcagatccttatgtgaagctgaaactt
attcctgatcccaagaatgaaagcaagcaaaaaaccaaaaccatccgctccacactaaat
ccccagtggaatgagtcctttacattcaaattgaaaccttcagacaaagaccgacgactg
tctgtagaaatctgggactgggatcgaacaacaaggaatgacttcatgggatccctttcc
tttggagtttcggagctaatgaagatgccggccagtggatggtacaagttgcttaaccaa
gaagaaggtgagtactacaatgtacccattccagaaggggacgaagaaggaaacatggaa
ctcaggcagaaattcgagaaagccaaacttggccctgctggcaacaaagtcatcagtccc
tctgaagacaggaaacaaccttccaacaaccttgaccgagtgaaactcacggacttcaat
ttcctcatggtgttggggaagggcagttttggaaaggtgatgcttgctgacaggaagggc
acagaagaactgtatgcaatcaaaatcctaaagaaggatgtggtgattcaggatgatgac
gtggagtgcaccatggtagaaaagcgagtcttggccctgcttgacaaacccccgttcttg
acgcagctgcactcctgcttccagacagtggatcggctgtacttcgtcatggagtatgtc
aacggtggggacctcatgtaccacattcagcaagtaggaaaatttaaggaaccacaagca
gtattctatgcggcagagatttccatcggattgttctttcttcataaaagaggaatcatt
tatagggatctgaagttagataacgtcatgttggattcagaaggacatatcaaaattgct
gactttgggatgtgcaaggaacacatgatggatggagtcacgaccaggaccttctgtgga
actccagattacatcgccccagagataatcgcttatcagccgtatggaaaatctgtggac
tggtgggcctatggcgtcctgttgtatgaaatgcttgctgggcagcctccatttgatggt
gaagatgaagacgagctatttcagtctatcatggagcacaacgtttcctatccaaaatcc
ttgtccaaggaggctgtttctatctgcaaaggactgatgaccaaacacccagccaagcgg
ctgggctgtgggcctgagggggagagggacgtgagagaacatgccttcttccggaggatc
gactgggaaaaactggagaacagggagatccagccaccattcaagcccaaagtgtgcggc
aaaggagcagaaaactttgacaagttcttcacacgaggacagcccgtcttaacaccgcct
gatcagctggttattgctaacatagaccagtctgattttgaagggttctcgtatgtcaat
ccccagtttgtgcaccccatcttacagagtgcagtatga

KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100601464
Entry
100601464         CDS       T03265                                 

Gene name
PRKCG
Definition
(RefSeq) protein kinase C gamma type
  KO
K19663  classical protein kinase C gamma type [EC:2.7.11.13]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle01521  EGFR tyrosine kinase inhibitor resistance
nle04010  MAPK signaling pathway
nle04012  ErbB signaling pathway
nle04014  Ras signaling pathway
nle04015  Rap1 signaling pathway
nle04020  Calcium signaling pathway
nle04066  HIF-1 signaling pathway
nle04070  Phosphatidylinositol signaling system
nle04071  Sphingolipid signaling pathway
nle04150  mTOR signaling pathway
nle04270  Vascular smooth muscle contraction
nle04310  Wnt signaling pathway
nle04370  VEGF signaling pathway
nle04510  Focal adhesion
nle04540  Gap junction
nle04613  Neutrophil extracellular trap formation
nle04650  Natural killer cell mediated cytotoxicity
nle04666  Fc gamma R-mediated phagocytosis
nle04670  Leukocyte transendothelial migration
nle04713  Circadian entrainment
nle04720  Long-term potentiation
nle04723  Retrograde endocannabinoid signaling
nle04724  Glutamatergic synapse
nle04725  Cholinergic synapse
nle04726  Serotonergic synapse
nle04727  GABAergic synapse
nle04728  Dopaminergic synapse
nle04730  Long-term depression
nle04750  Inflammatory mediator regulation of TRP channels
nle04911  Insulin secretion
nle04916  Melanogenesis
nle04918  Thyroid hormone synthesis
nle04919  Thyroid hormone signaling pathway
nle04921  Oxytocin signaling pathway
nle04925  Aldosterone synthesis and secretion
nle04928  Parathyroid hormone synthesis, secretion and action
nle04929  GnRH secretion
nle04935  Growth hormone synthesis, secretion and action
nle04960  Aldosterone-regulated sodium reabsorption
nle04961  Endocrine and other factor-regulated calcium reabsorption
nle04970  Salivary secretion
nle04971  Gastric acid secretion
nle04972  Pancreatic secretion
nle05017  Spinocerebellar ataxia
nle05022  Pathways of neurodegeneration - multiple diseases
nle05031  Amphetamine addiction
nle05032  Morphine addiction
nle05143  African trypanosomiasis
nle05146  Amoebiasis
nle05161  Hepatitis B
nle05163  Human cytomegalovirus infection
nle05170  Human immunodeficiency virus 1 infection
nle05171  Coronavirus disease - COVID-19
nle05200  Pathways in cancer
nle05205  Proteoglycans in cancer
nle05206  MicroRNAs in cancer
nle05214  Glioma
nle05223  Non-small cell lung cancer
nle05225  Hepatocellular carcinoma
nle05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100601464 (PRKCG)
   04012 ErbB signaling pathway
    100601464 (PRKCG)
   04014 Ras signaling pathway
    100601464 (PRKCG)
   04015 Rap1 signaling pathway
    100601464 (PRKCG)
   04310 Wnt signaling pathway
    100601464 (PRKCG)
   04370 VEGF signaling pathway
    100601464 (PRKCG)
   04066 HIF-1 signaling pathway
    100601464 (PRKCG)
   04020 Calcium signaling pathway
    100601464 (PRKCG)
   04070 Phosphatidylinositol signaling system
    100601464 (PRKCG)
   04071 Sphingolipid signaling pathway
    100601464 (PRKCG)
   04150 mTOR signaling pathway
    100601464 (PRKCG)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100601464 (PRKCG)
   04540 Gap junction
    100601464 (PRKCG)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100601464 (PRKCG)
   04650 Natural killer cell mediated cytotoxicity
    100601464 (PRKCG)
   04666 Fc gamma R-mediated phagocytosis
    100601464 (PRKCG)
   04670 Leukocyte transendothelial migration
    100601464 (PRKCG)
  09152 Endocrine system
   04911 Insulin secretion
    100601464 (PRKCG)
   04929 GnRH secretion
    100601464 (PRKCG)
   04921 Oxytocin signaling pathway
    100601464 (PRKCG)
   04935 Growth hormone synthesis, secretion and action
    100601464 (PRKCG)
   04918 Thyroid hormone synthesis
    100601464 (PRKCG)
   04919 Thyroid hormone signaling pathway
    100601464 (PRKCG)
   04928 Parathyroid hormone synthesis, secretion and action
    100601464 (PRKCG)
   04916 Melanogenesis
    100601464 (PRKCG)
   04925 Aldosterone synthesis and secretion
    100601464 (PRKCG)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100601464 (PRKCG)
  09154 Digestive system
   04970 Salivary secretion
    100601464 (PRKCG)
   04971 Gastric acid secretion
    100601464 (PRKCG)
   04972 Pancreatic secretion
    100601464 (PRKCG)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100601464 (PRKCG)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100601464 (PRKCG)
  09156 Nervous system
   04724 Glutamatergic synapse
    100601464 (PRKCG)
   04727 GABAergic synapse
    100601464 (PRKCG)
   04725 Cholinergic synapse
    100601464 (PRKCG)
   04728 Dopaminergic synapse
    100601464 (PRKCG)
   04726 Serotonergic synapse
    100601464 (PRKCG)
   04720 Long-term potentiation
    100601464 (PRKCG)
   04730 Long-term depression
    100601464 (PRKCG)
   04723 Retrograde endocannabinoid signaling
    100601464 (PRKCG)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100601464 (PRKCG)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100601464 (PRKCG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100601464 (PRKCG)
   05206 MicroRNAs in cancer
    100601464 (PRKCG)
   05205 Proteoglycans in cancer
    100601464 (PRKCG)
   05231 Choline metabolism in cancer
    100601464 (PRKCG)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100601464 (PRKCG)
   05214 Glioma
    100601464 (PRKCG)
   05223 Non-small cell lung cancer
    100601464 (PRKCG)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    100601464 (PRKCG)
   05022 Pathways of neurodegeneration - multiple diseases
    100601464 (PRKCG)
  09165 Substance dependence
   05031 Amphetamine addiction
    100601464 (PRKCG)
   05032 Morphine addiction
    100601464 (PRKCG)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100601464 (PRKCG)
   05161 Hepatitis B
    100601464 (PRKCG)
   05171 Coronavirus disease - COVID-19
    100601464 (PRKCG)
   05163 Human cytomegalovirus infection
    100601464 (PRKCG)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100601464 (PRKCG)
   05143 African trypanosomiasis
    100601464 (PRKCG)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100601464 (PRKCG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nle01001]
    100601464 (PRKCG)
Enzymes [BR:nle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     100601464 (PRKCG)
Protein kinases [BR:nle01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   100601464 (PRKCG)
SSDB
Motif
Pfam: Pkinase C1_1 PK_Tyr_Ser-Thr C2 Pkinase_C Kinase-like APH
Other DBs
NCBI-GeneID: 100601464
NCBI-ProteinID: XP_003259784
Ensembl: ENSNLEG00000006202
UniProt: G1R2Y3
LinkDB
Position
10
AA seq 697 aa
MAGLGPGGGDSEGGPRPLFCRKGALRQKVVHEVKSHKFTARFFKQPTFCSHCTDFIWGIG
KQGLQCQVCSFVVHRRCHEFVTFECPGAGKGPQTDDPRNKHKFRLHSYSSPTFCDHCGSL
LYGLVHQGMKCSCCEMNVHRRCVRSVPSLCGVDHTERRGRLQLEIRAPTADEIHITVGEA
RNLIPMDPNGLSDPYVKLKLIPDPRNLTKQKTRTVKATLNPVWNETFVFNLKPGDVERRL
SVEVWDWDRTSRNDFMGAMSFGVSELLKAPVDGWYKLLNQEEGEYYNVPVADADNCSLLQ
KFEACNYPLELYERVRMGPSSSPIPSPSPSPTDPKRCFFGVSPGRLHISDFSFLMVLGKG
SFGKVMLAERRGSDELYAIKILKKDVIVQDDDVDCTLVEKRVLALGGRGPGGRPHFLTQL
HSTFQTPDRLYFVMEYVTGGDLMYHIQQLGKFKEPHAAFYAAEIAIGLFFLHNQGIIYRD
LKLDNVMLDAEGHIKITDFGMCKENVFPGTTTRTFCGTPDYIAPEIIAYQPYGKSVDWWS
FGVLLYEMLAGQPPFDGEDEEELFQAIMEQTVTYPKSLSREAVAICKGFLTKHPGKRLGS
GPDGEPTIRAHGFFRWIDWERLERLEIPPPFRPRPCGRSGENFDKFFTRAAPALTPPDRL
VLASIDQADFQGFTYVNPDFVHPDARSPTSPVPVPVM
NT seq 2094 nt   +upstreamnt  +downstreamnt
atggctggtctgggcccgggcggaggcgattcagaggggggaccccggcccctgttttgc
agaaagggggctctgaggcagaaggtggtccacgaagtcaaaagccacaagttcaccgct
cgcttcttcaagcagcccaccttctgcagccactgcaccgacttcatctggggtatcgga
aagcagggcctgcaatgtcaagtctgcagctttgtggttcatcgacgatgccacgaattt
gtgaccttcgagtgtccaggcgctgggaagggcccccagacggacgacccccggaacaaa
cacaagttccgcctgcatagctacagcagccccaccttctgcgaccactgtggctccctc
ctctacgggcttgtgcaccagggcatgaaatgctcctgctgcgagatgaacgtgcaccgg
cgctgtgtgcgtagcgtgccctccctgtgcggtgtggaccacaccgagcgccgcggacgc
ctgcagctggagatccgggctcctacagcagatgagatccacataacggttggcgaggcc
cgtaacctaattcctatggaccccaatggtctctctgatccctatgtgaaactgaagctc
atcccagaccctcggaacctgacgaaacagaagacccgaacggtgaaagccacgctaaac
cctgtgtggaatgagacctttgtattcaacctgaagccaggggatgtggaacgccggctc
agcgtggaggtgtgggactgggaccggacctcccgcaacgacttcatgggggccatgtcc
tttggcgtctcggagctgctgaaggcgcccgtggatggctggtacaagttactgaaccag
gaggagggcgagtattacaatgtgccggtggccgatgctgacaactgcagcctcctccag
aagtttgaggcttgtaactaccccctggaattgtatgagcgggtgcggatgggcccctct
tcctctcccatcccttccccttcccctagtcccaccgaccccaagcgctgcttcttcggg
gtgagcccaggacgcctgcacatctccgacttcagcttcctcatggttctaggaaaaggc
agttttgggaaggtgatgctggccgagcgcaggggctccgatgagctctacgccatcaag
atcttgaaaaaggacgtgatcgtccaggacgacgatgtggactgcacgctggtggagaaa
cgtgtgctggcactggggggccggggtcctggcggccggccccacttcctcacccagctc
cactccaccttccagaccccggaccgcctgtatttcgtgatggagtatgtcaccggggga
gacttgatgtaccacattcaacagctgggcaagtttaaggagccccatgcagcgttctac
gcggcagaaatcgctatcggcctcttcttccttcacaatcagggcatcatctacagggac
ctgaagctggacaatgtgatgctggatgctgagggacacatcaagatcactgacttcggc
atgtgtaaggagaacgtcttccctgggacgacaacccgcaccttctgcgggaccccggac
tacatagccccggagatcattgcctaccagccctatgggaagtctgtcgattggtggtcc
tttggagttctgctgtatgagatgttggcaggacagcctcccttcgatggggaggacgag
gaggagctgtttcaggccatcatggaacaaactgtcacctaccccaagtcgctttcccgg
gaagccgtggccatctgcaaggggttcctgaccaagcacccagggaagcgcctgggctca
gggcctgatggggaacctaccatccgtgcacatggctttttccgctggattgactgggag
cggctggaacgattggagatcccgcctcctttcagaccccgcccgtgtggccgcagcggc
gagaactttgacaagttcttcacgcgggcggcgccagcgctgacccctccagaccgccta
gtcctggccagcatcgaccaggccgatttccagggcttcacctacgtgaaccccgacttc
gtgcacccggatgcccgcagccccaccagcccagtgcctgtgcccgtcatgtaa

DBGET integrated database retrieval system