KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100591090Help
Entry
100591090         CDS       T03265                                 

Gene name
PTGS2
Definition
(RefSeq) prostaglandin-endoperoxide synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle00590  Arachidonic acid metabolism
nle01100  Metabolic pathways
nle04064  NF-kappa B signaling pathway
nle04370  VEGF signaling pathway
nle04625  C-type lectin receptor signaling pathway
nle04657  IL-17 signaling pathway
nle04668  TNF signaling pathway
nle04723  Retrograde endocannabinoid signaling
nle04726  Serotonergic synapse
nle04913  Ovarian steroidogenesis
nle04921  Oxytocin signaling pathway
nle04923  Regulation of lipolysis in adipocytes
nle05140  Leishmaniasis
nle05163  Human cytomegalovirus infection
nle05165  Human papillomavirus infection
nle05167  Kaposi sarcoma-associated herpesvirus infection
nle05200  Pathways in cancer
nle05204  Chemical carcinogenesis
nle05206  MicroRNAs in cancer
nle05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:nle00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    100591090 (PTGS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    100591090 (PTGS2)
   04064 NF-kappa B signaling pathway
    100591090 (PTGS2)
   04668 TNF signaling pathway
    100591090 (PTGS2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100591090 (PTGS2)
   04657 IL-17 signaling pathway
    100591090 (PTGS2)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    100591090 (PTGS2)
   04913 Ovarian steroidogenesis
    100591090 (PTGS2)
   04921 Oxytocin signaling pathway
    100591090 (PTGS2)
  09156 Nervous system
   04726 Serotonergic synapse
    100591090 (PTGS2)
   04723 Retrograde endocannabinoid signaling
    100591090 (PTGS2)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    100591090 (PTGS2)
   05206 MicroRNAs in cancer
    100591090 (PTGS2)
   05204 Chemical carcinogenesis
    100591090 (PTGS2)
  09162 Cancers: Specific types
   05222 Small cell lung cancer
    100591090 (PTGS2)
  09172 Infectious diseases: Viral
   05163 Human cytomegalovirus infection
    100591090 (PTGS2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100591090 (PTGS2)
   05165 Human papillomavirus infection
    100591090 (PTGS2)
  09174 Infectious diseases: Parasitic
   05140 Leishmaniasis
    100591090 (PTGS2)
Enzymes [BR:nle01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     100591090 (PTGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF
Motif
Other DBs
NCBI-GeneID: 100591090
NCBI-ProteinID: XP_003264523
UniProt: G1S8S7
LinkDB All DBs
Position
9
AA seq 604 aa AA seqDB search
MLARALLLCAVLALSHAANPCCSHPCQNRGVCMSVGFDQYKCDCTRTGFYGENCSTPEFL
TRIKLLLKPTPNTVHYILTHFKGFWNVVNNIPFLRNAIMSYVLTSRSHLIDSPPTYNVDY
GYKSWEAFSNLSYYTRALPPVPDDCPTPLGVKGKKQLPDSNEIVEKFLLRRKFIPDPQGT
NVMFAFFAQHFTHQFFKTDHKRGPAFTKGLGHGVDLNHIYGETLDRQHKLRLFKDGKMKY
QIIDGEMYPPTVKDTQAEMIYPPQVPEHLRFAVGQEVFGLVPGLMMYATIWLREHNRVCD
VLKQEHPEWGDEQLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNKQFQYQ
NRIAAEFNTLYHWHPLLPDTFQIHDQNYNYQQFIYNNSILLEHGITQFVESFTRQIAGRV
AGGRNVPPAVQKVSQASIDQSRQMKYQSFNEYRKRFMLKPYESFEELTGEKEMSAELEAL
YGDIDAVELYPALLVEKPRPDAIFGETMVEVGAPFSLKGLMGNVICSPDYWKPSTFGGEV
GFQIINTASIQSLICNNVKGCPFASFSVPDPELIKTVTINASSSRSGLDDINPTVLLKER
STEL
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgctagcccgcgccctgctgctgtgcgcggtcctggcgctcagccatgcagcaaatcct
tgctgttcccacccatgtcaaaaccgaggtgtatgtatgagtgtgggatttgaccagtat
aagtgcgattgtacccggacaggattctatggtgaaaactgctcaacaccggaatttctg
acaagaataaaattacttctgaaacccactccaaacacagtgcactacatacttacccac
ttcaagggattttggaacgttgtgaataacattcccttccttcgaaatgcaattatgagt
tatgtgttgacatccagatcacatttgattgacagtccaccaacttacaacgttgactat
ggctacaaaagctgggaagccttctctaacctctcctattataccagagcccttcctcct
gtgcctgatgactgcccgactcccttgggtgtcaaaggtaaaaagcagcttcctgattca
aatgaaattgtggaaaagtttcttctaagaagaaagttcatccctgatccccagggcaca
aacgtgatgtttgcattctttgcccagcacttcacacatcagtttttcaagacagatcat
aagcgagggccagctttcaccaaagggctgggccatggggtggatttaaatcatatttac
ggtgaaactctggatagacagcataaactgcgccttttcaaggatggaaaaatgaaatat
cagataattgatggagagatgtatcctcccacagtcaaagatactcaggcagagatgatc
taccctcctcaagtccctgagcatctacggtttgctgtggggcaggaggtctttggtctg
gtgcctggtctgatgatgtatgccacaatctggctgcgggaacacaacagagtatgcgat
gtgcttaaacaggagcatcccgaatggggtgatgagcagttgttccagacaagcaggcta
atactgataggagagactattaagattgtgattgaagattatgtgcagcacttgagtggc
tatcacttcaaactgaaatttgacccagagctacttttcaacaaacaattccagtaccaa
aatcgtattgctgctgagtttaacaccctctatcactggcatccccttctgcctgacacc
tttcaaattcatgaccagaactacaactatcaacagtttatctacaacaattctatattg
ctggaacatggaattacccagtttgttgaatcattcaccaggcaaattgctggcagggtt
gctggtggtaggaatgttccacctgcagtacaaaaagtatcacaggcttccattgaccag
agcaggcagatgaaataccagtcttttaatgagtaccgcaaacgctttatgctgaagccc
tatgaatcatttgaagaacttacaggagaaaaggaaatgtctgcagagttggaagcactc
tatggtgacatcgatgctgtggagctgtatcctgcccttctggtagaaaagcctcgtcca
gatgccatctttggtgagaccatggtagaagttggagcaccattctccttgaaaggactt
atgggtaatgttatatgttctcctgactactggaagccaagcacttttggtggagaagtg
ggttttcaaatcatcaacactgcctcaattcagtctctcatctgcaataacgtgaagggc
tgtccctttgcgtcattcagtgttccagatccagagctcatcaagacagtcaccatcaat
gcaagttcttcccgctccggactagatgatatcaatcccacagtactactgaaagaacgt
tcgactgaactgtag

DBGET integrated database retrieval system