KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100591545Help
Entry
100591545         CDS       T03265                                 

Definition
(RefSeq) trypsin-like
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04080  Neuroactive ligand-receptor interaction
nle04972  Pancreatic secretion
nle04974  Protein digestion and absorption
nle05164  Influenza A
Brite
KEGG Orthology (KO) [BR:nle00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100591545
 Organismal Systems
  Digestive system
   04972 Pancreatic secretion
    100591545
   04974 Protein digestion and absorption
    100591545
 Human Diseases
  Infectious diseases
   05164 Influenza A
    100591545
Enzymes [BR:nle01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     100591545
Peptidases [BR:nle01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   100591545
Exosome [BR:nle04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100591545
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2
Motif
Other DBs
NCBI-GeneID: 100591545
NCBI-ProteinID: XP_003270887
LinkDB All DBs
Position
13
AA seq 247 aa AA seqDB search
MKTFIFLALLGAAAAFPASDDDDKIVGGYTCQRNSVPYQVXLNAGYHFCGGSLINNKWVV
SVAHCYKSRIQVRLGEYNIKAYEGNXQFINAAKIICHPRYNSATIDNDIMLVKLSSAATI
NSQVATTSLPRSCTAAGTQCLISGWGNTLSSGTNYPDLLQCLKAPILSNTACCTAYPGKI
TTNMICLGFLEGGKDSCQGDSGGPVVCKGELQVIVSWAYGCAQKNKPGVYTKVCNYVKWI
QQTIAAN
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaagactttcatcttccttgctctcctgggagctgctgctgctttccccgctagtgat
gatgatgacaagatcgttgggggctacacctgtcagaggaattctgtcccctatcaggtg
ntcctgaatgctggctatcacttctgtggcggctccctcatcaataacaaatgggtggtg
tccgtggctcactgctacaagtctagaatccaagtgcgtctgggagaatacaacattaag
gcctatgaaggcaatnngcaattcataaatgcagccaagattatttgccaccccaggtat
aactcagccaccattgataatgacatcatgctggttaagctgagctcagccgccaccatc
aactctcaagtggccaccacctctctgccaagatcctgtacagcggctggtactcagtgc
ctcatctctggctggggcaacaccctgagcagtggcaccaactaccctgatctcctgcag
tgtctgaaggctcccattctctctaacactgcttgctgcacagcctacccaggcaagatt
actacaaacatgatatgtctgggattcctggagggtggaaaggactcttgccagggtgac
tctggtggccctgttgtctgcaaaggagaactccaggtaattgtctcctgggcctatggt
tgtgctcagaagaacaaacctggagtctacactaaagtttgcaactacgtgaaatggatt
cagcagaccattgctgccaactga

DBGET integrated database retrieval system