KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100591684Help
Entry
100591684         CDS       T03265                                 

Gene name
HDAC2
Definition
(RefSeq) histone deacetylase 2
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04110  Cell cycle
nle04213  Longevity regulating pathway - multiple species
nle04330  Notch signaling pathway
nle04919  Thyroid hormone signaling pathway
nle05016  Huntington disease
nle05034  Alcoholism
nle05165  Human papillomavirus infection
nle05169  Epstein-Barr virus infection
nle05200  Pathways in cancer
nle05202  Transcriptional misregulation in cancer
nle05203  Viral carcinogenesis
nle05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    100591684 (HDAC2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100591684 (HDAC2)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100591684 (HDAC2)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    100591684 (HDAC2)
 09160 Human Diseases
  09161 Cancers
   05200 Pathways in cancer
    100591684 (HDAC2)
   05202 Transcriptional misregulation in cancers
    100591684 (HDAC2)
   05203 Viral carcinogenesis
    100591684 (HDAC2)
   05220 Chronic myeloid leukemia
    100591684 (HDAC2)
  09163 Neurodegenerative diseases
   05016 Huntington disease
    100591684 (HDAC2)
  09164 Substance dependence
   05034 Alcoholism
    100591684 (HDAC2)
  09167 Infectious diseases
   05169 Epstein-Barr virus infection
    100591684 (HDAC2)
   05165 Human papillomavirus infection
    100591684 (HDAC2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:nle03036]
    100591684 (HDAC2)
Enzymes [BR:nle01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100591684 (HDAC2)
Chromosome and associated proteins [BR:nle03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     100591684 (HDAC2)
   HDAC complexes
    Sin3A-HDAC complex
     100591684 (HDAC2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    100591684 (HDAC2)
  Chromatin remodeling factors
   NuRD complex
    100591684 (HDAC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 100591684
NCBI-ProteinID: XP_003255642
LinkDB All DBs
Position
3
AA seq 579 aa AA seqDB search
MRPPPCGLRRWFGGPLLASWCRCHPRFRAFGISAGWYRAFPAPPPLLPPACPSPRDYRPH
VSLSPFLSRPSRGGSSSSRRRSPEAAVAGEPMAYSQGGGKKKVCYYYDGDIGNYYYGQGH
PMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFLRSIRPDNMSEYS
KQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEAS
GFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGT
GDLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSG
DRLGCFNLTVKGHAKCVEVVKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPNEL
PYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPEDA
VHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKARIEE
DKKETEDKKADVKEEDKSKDNSGEKTDTKGTKSEQLSNP
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atgcgcccacctccctgcggcctccggaggtggtttggtggccccctcctcgcgagttgg
tgccgctgccacccccgattccgagctttcggcatctccgccgggtggtaccgagccttc
ccggcgccccctcctctcctcccaccggcctgcccttccccgcgggactaccgcccccac
gtttccctcagcccttttctctcccggccgagccgcggcggcagcagcagcagcaggagg
aggagcccggaggcggcggtggccggggagcccatggcgtacagtcaaggaggcggcaaa
aaaaaagtctgctactactacgacggtgatattggaaattattattatggacagggtcat
cccatgaagcctcatagaatccgcatgacccataacttgctgttaaattatggcttatac
agaaaaatggaaatatataggccccataaagccactgctgaagaaatgacaaaatatcac
agtgatgagtatatcaaatttctacggtcaataagaccagataacatgtctgagtatagt
aagcagatgcagagatttaatgttggagaagattgtccagtgtttgatggactctttgag
ttttgtcagctctcaactggcggttcagttgctggagctgtgaagttaaaccgacaacag
actgatatggctgttaattgggctggaggattacatcatgctaagaagtcagaagcatca
ggattctgttatgttaatgatattgtgcttgccatccttgaattactaaagtatcatcag
agagtcttatatattgatatagatattcatcatggtgatggtgttgaagaagctttttat
acgacagatcgtgtaatgactgtatcattccataaatatggggaatactttcctggcaca
ggagacttgagggatattggtgctggaaaaggcaaatactatgctgtcaattttccaatg
agagatggtatagatgatgagtcatatgggcagatatttaagcctattatctcaaaggtg
atggagatgtatcaacctagtgctgtggtattacagtgtggtgcagactcattgtctggt
gatagactgggttgtttcaatctaacagtcaaaggtcatgctaaatgtgtagaagttgta
aaaacttttaacttaccattactgatgcttggaggaggtggctacacaatccgtaatgtt
gctcgatgttggacatatgagactgcagttgcccttgattgtgagattcccaatgagttg
ccatataatgattactttgagtattttggaccagacttcaagctgcatattagtccttca
aacatgacaaaccagaacactccagaatatatggaaaagataaaacagcgtttatttgaa
aatttgcgcatgttacctcatgcacctggtgtccagatgcaagctattccagaagatgct
gttcatgaagacagtggagatgaagatggagaagatccagacaagagaatttctattcga
gcatcagacaagcggatagcttgtgatgaagaattctcagattctgaggatgaaggagaa
ggaggtcgaagaaatgtggctgatcataagaaaggagcaaagaaagctagaattgaagaa
gataagaaagaaacagaggacaaaaaagcagacgttaaggaagaagataaatccaaggac
aacagtggtgaaaaaaccgataccaaaggaaccaaatcagaacagctcagcaacccctga

DBGET integrated database retrieval system