KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100592025Help
Entry
100592025         CDS       T03265                                 

Gene name
ALPPL2
Definition
(RefSeq) alkaline phosphatase, placental like 2
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle00730  Thiamine metabolism
nle00790  Folate biosynthesis
nle01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nle00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    100592025 (ALPPL2)
   00790 Folate biosynthesis
    100592025 (ALPPL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nle04147]
    100592025 (ALPPL2)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:nle00537]
    100592025 (ALPPL2)
Enzymes [BR:nle01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     100592025 (ALPPL2)
Exosome [BR:nle04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100592025 (ALPPL2)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:nle00537]
 Enzymes
  100592025 (ALPPL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alk_phosphatase
Motif
Other DBs
NCBI-GeneID: 100592025
NCBI-ProteinID: XP_003274790
UniProt: G1RVL3
LinkDB All DBs
Position
22a
AA seq 529 aa AA seqDB search
MWGPCVLRLLGLRLQLSLGIIPVEEENPDFWNRQAAEALGAAKKLQPAQTAAKNLILFLG
DGMGVSTVTAARILKGQKKGKLGPETFLAMDRFPYVALSKTYSVDKHVPDSAATATAYLC
GVKSNFQTIGLSAAARFNQCNTTRGNEVISVMNRAKKAGKSVGVVTTTRVQHASPAGAYA
HTVNRNWYSDADMPASARREGCRDIATQLISNMDIDVILGGGRKYMFPMGTPDPEYPDDY
SQGGTRLDGKNLVQEWLAKHQGARYVWNRTELMQASLDPSVTHLMGLFEPGDMKYEIHRD
STLDPSLVEMTEAALHLLSRNPCGFFLFVEGGRIDHGHHESRAYRALTETVMFDDAIERA
GQLTSEEDTLTLVTADHSHVFSFGGYPLRGSSIFGLAPGKARDRKSYTVLLYGNGPGYVL
KDGARPDVTESESGSPEYRQQSAVPLDGETHAGEDVAVFARGPQAHLVHGVQEQSFVAHV
MAFAACLEPYKACDLEAPTCSTNAAHPGTSVIPALLPLLAGTLRTATAP
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgtgggggccctgcgtgctgcggctgctgggcctcaggctacagctctccctcggcatc
atcccagttgaggaggagaacccggacttctggaaccgccaggcagccgaggccctgggt
gccgccaagaagctgcagcctgcacagacagccgccaagaacctcatcctcttcctgggc
gacgggatgggagtgtctacggtgacagctgccaggatcctaaaagggcagaagaagggc
aaactggggcctgagaccttcctggccatggaccgcttcccatacgtggctctgtccaag
acatacagtgtagacaagcatgtgccagacagcgcagccacagccacggcctacctgtgc
ggggtcaagagcaacttccagaccatcggcttgagtgcagccgcccgctttaaccagtgc
aacacaacacgcggcaacgaggtcatctccgtgatgaatcgggccaagaaagcaggaaag
tcagtgggagtggtaaccaccacacgggtgcagcatgcctcgccagccggcgcctacgcc
cacacggtgaaccgcaactggtactcggatgccgacatgcctgcctcggcccgccgggag
ggctgcagggacatcgccacgcagctcatctccaacatggacattgacgtgatcctaggt
ggaggccgaaagtacatgtttcccatggggaccccagaccctgagtacccagatgactac
agccaaggtgggaccaggctggacgggaagaatctggtgcaggaatggctggcaaagcac
cagggtgcccggtacgtgtggaatcgcactgagctcatgcaggcttccctggacccgtct
gtgacccatctcatgggtctctttgagcccggagatatgaaatacgagatccaccgagac
tccacactggacccctccctggtggagatgacggaggctgccctgcatctgctgagcagg
aacccctgcggcttcttcctcttcgtggagggtggtcgcatcgaccatggtcatcatgaa
agcagggcttaccgggcactgactgagacggtcatgttcgacgacgccattgagagggcg
ggccagctcaccagcgaggaggacacgctgaccctcgtcaccgctgaccactcccacgtc
ttctccttcggaggctaccccctgcgagggagctccatcttcgggctggcccctggcaag
gcccgggacaggaagtcctacacggtcctcctatacggaaacggtccgggctatgtgctc
aaggacggcgcccggccggatgttaccgagagcgagagcgggagccccgagtatcggcag
cagtcagcagtgcccctggacggagagacccacgcaggcgaggacgtggcagtgttcgcg
cgcggcccgcaggcgcatctggttcacggcgtgcaagagcagagctttgtagcgcacgtc
atggccttcgctgcctgcctggagccctacaaggcctgcgacctggaggcccccacctgc
tccaccaacgccgcgcacccggggacgtccgtgatccccgcgttgcttcctctgctggca
gggaccttgaggacggccactgctccctga

DBGET integrated database retrieval system