KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100592225Help
Entry
100592225         CDS       T03265                                 

Gene name
OGDH
Definition
(RefSeq) oxoglutarate dehydrogenase
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle00020  Citrate cycle (TCA cycle)
nle00310  Lysine degradation
nle00380  Tryptophan metabolism
nle01100  Metabolic pathways
nle01200  Carbon metabolism
Module
nle_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
nle_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Brite
KEGG Orthology (KO) [BR:nle00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100592225 (OGDH)
  09105 Amino acid metabolism
   00310 Lysine degradation
    100592225 (OGDH)
   00380 Tryptophan metabolism
    100592225 (OGDH)
Enzymes [BR:nle01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     100592225 (OGDH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E1_dh Transket_pyr OxoGdeHyase_C 2-oxogl_dehyd_N GGA_N-GAT R2K_2
Motif
Other DBs
NCBI-GeneID: 100592225
NCBI-ProteinID: XP_003268915
UniProt: A0A2I3GT55
LinkDB All DBs
Position
17
AA seq 1023 aa AA seqDB search
MFHLRTCAAKLRPLTASQTVKTFSQNRPAAARTFQQIRCYSAPVAAEPFLSGTSSNYVEE
MYCAWLENPKSVHKSWDIFFRNTNAGAPPGTAYQSPLPLSRGSLAAVAHAQSLVEAQPNV
DKLVEDHLAVQSLIRAYQIRGHHVAQLDPLGILDADLDSSVPADIISSTDKLGFYGLDES
DLDKVFHLPTTTFIGGQESALPLREIIRRLEMAYCQHIGVEFMFINDLEQCQWIRQKFET
PGIMQFTNEEKRTLLARLVRSTRFEEFLQRKWSSEKRFGLEGCEVLIPALKTIIDKSSEN
GVDYVIMGMPHRGRLNVLANVIRKELEQIFCQFDSKLEAADEGSGDVKYHLGMYHRRINR
VTDRNITLSLVANPSHLEAADPVVMGKTKAEQFYCGDTEGKKVMSILLHGDAAFAGQGIV
YETFHLSDLPSYTTHGTVHVVVNNQIGFTTDPRMARSSPYPTDVARVVNAPIFHVNSDDP
EAVMYVCKVAAEWRSTFHKDVVVDLVCYRRNGHNEMDEPMFTQPLMYKQIRKQKPVLQKY
AELLVSQGVVNQPEYEEEISKYDKICEEAFARSKDEKILHIKHWLDSPWPGFFTLDGQPR
SMSCPSTGLTEDILTHIGNVASSVPVENFTIHGGLSRILKTRGEMVKNRTVDWALAEYMA
FGSLLKEGIHIRLSGQDVERGTFSHRHHVLHDQNVDKRTCIPMNHLWPNQAPYTVCNSSL
SEYGVLGFELGFAMASPNALVLWEAQFGDFHNTAQCIIDQFICPGQAKWVRQNGIVLLLP
HGMEGMGPEHSSARPERFLQMCNDDPDVLPDLKEANFDINQLYDCNWVVVNCSTPGNFFH
VLRRQILLPFRKPLIIFTPKSLLRHPEARSSFDEMLPGTHFQRVIPEDGPAAQNPESVKR
LLFCTGKVYYDLTRERKARDMVGQVAITRIEQLSPFPFDLLLKEVQKYPSAELAWCQEEH
KNQGYYDYVKPRLRTTISRAKPVWYAGRDPAAAPATGNKKTHLTELQRLLDTAFDLDVFK
NFS
NT seq 3072 nt NT seq  +upstreamnt  +downstreamnt
atgtttcatttaaggacttgtgctgctaagttgaggccattgacggcttcccagactgtt
aagacattttcacaaaacagaccagcagcagctaggacatttcaacagattcggtgctat
tctgcacccgttgctgctgagccctttctcagtgggactagttcgaactatgtggaggag
atgtactgtgcttggctggaaaaccccaaaagtgtacataagtcatgggacatttttttt
cgcaacacgaatgccggagccccaccgggcactgcgtaccagagtccccttcccctgagc
cgaggctccctggctgctgtggcccatgcacagtccctggtggaagcacagcccaatgtg
gacaagctcgtggaagaccacctggcagtgcagtcgctcatcagggcatatcagatacga
gggcaccatgtagcacagctggaccccctggggattttggatgctgatctggactcctcc
gtgcccgctgacattatctcatccacagacaaacttgggttctatggcctggacgagtct
gacctcgacaaggtcttccacttgcccaccaccactttcatcgggggacaggaatcagca
cttcctctgcgggagatcatccgtcggctggagatggcctactgccagcatattggggtg
gagttcatgttcatcaatgacctggagcagtgccagtggatccggcagaagtttgagacc
cccgggatcatgcagttcacaaatgaggagaagcggaccctgctggccaggcttgtgcgg
tccaccaggtttgaggagttcctacagcggaagtggtcctctgagaagcgctttggtcta
gaaggctgtgaggtactgatccctgccctcaagaccatcatcgacaagtcgagtgagaat
ggcgtggactacgtgatcatgggcatgccacacagagggcggctgaatgtgcttgcaaat
gtcatcaggaaggagctggaacagatcttctgtcaattcgattcaaagctggaggcggct
gatgagggctccggagatgtgaagtaccacctgggcatgtaccaccgcaggatcaatcgt
gtcactgacaggaacattaccctgtccctggtggccaacccttcccaccttgaggccgct
gaccccgtggtgatgggcaagaccaaagctgaacagttctactgtggtgacactgaaggg
aaaaaggtcatgtccatcctgttgcatggggacgctgcatttgctggccagggcattgtg
tacgagaccttccacctcagcgacctgccatcctacacaactcatggcaccgtgcacgtg
gtcgtcaacaaccagatcggcttcaccaccgaccctcggatggcccgctcctccccctac
cccaccgacgtggcccgagtggtgaatgctcccattttccacgtgaactcagatgacccc
gaggctgtcatgtacgtgtgcaaagtggcggccgagtggaggagcaccttccacaaggac
gtggtcgtcgatttggtgtgttaccggcgcaacggccacaatgagatggatgagcccatg
ttcacgcagccgctcatgtacaagcagatccgcaagcagaagcctgtgttacagaagtac
gccgagctgctggtgtcgcagggtgtggtcaaccagcctgagtatgaggaggaaatttcc
aagtatgataagatctgtgaggaagcttttgccagatctaaagatgagaagatcttgcac
attaagcactggctggactctccctggcctggcttcttcaccctggacgggcagcccagg
agcatgtcctgcccctccacgggtctgacggaggatattctgacacacatcgggaatgtg
gctagttctgtgcctgtggaaaactttactattcatggagggctgagccggatcttgaag
actcgtggggaaatggtgaagaaccggactgtggactgggctctggcggagtacatggca
tttggctcactcctgaaggagggcatccacatccggctgagcggccaggacgtggagcgg
ggcacattcagccaccgccaccatgtgctccacgaccagaacgtggacaagagaacctgc
atccccatgaaccatctctggcccaatcaggccccctatactgtgtgcaacagctcactg
tctgagtacggcgtgctgggctttgagctgggcttcgccatggccagtcctaatgccctg
gtcctctgggaagcccaatttggtgacttccataacacggcccagtgcatcatcgaccag
ttcatctgcccgggacaagccaagtgggtgcggcagaatggcatcgtgttgctgctgccc
catggcatggagggcatgggtccagaacattcctccgcccgcccagagcggttcctgcag
atgtgcaacgatgacccagacgtcctgccagaccttaaagaagccaacttcgacatcaat
cagctgtatgactgcaattgggttgttgtcaactgctccacccctggcaacttcttccac
gtgctacgacgccagatcctgctgcccttccggaagccgttaattatcttcacccccaaa
tccctgttgcgccaccccgaggccagatccagctttgatgagatgcttccaggaacacac
ttccagcgggtgatcccagaagatggccctgcagctcagaacccagagagtgtcaaaagg
cttctcttctgcactggcaaagtgtattatgacctcacccgggagcgcaaagcacgcgac
atggtggggcaggtggccatcacaaggattgagcagctgtcgccattcccctttgacctc
ctgctgaaggaggtgcagaagtaccccagtgctgagctggcctggtgccaggaggagcac
aagaaccaaggctactatgactacgtgaagccaagacttcggaccaccatcagccgtgcc
aagcccgtctggtatgccggccgggacccagcggctgctccagccaccggcaacaagaag
acccacctgacggagctgcagcgcctcctggacacggccttcgacctggacgtcttcaag
aacttctcgtag

DBGET integrated database retrieval system