KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100592562Help
Entry
100592562         CDS       T03265                                 

Definition
(RefSeq) trypsin-1
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04080  Neuroactive ligand-receptor interaction
nle04972  Pancreatic secretion
nle04974  Protein digestion and absorption
nle05164  Influenza A
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100592562
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    100592562
   04974 Protein digestion and absorption
    100592562
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05164 Influenza A
    100592562
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:nle01002]
    100592562
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nle04147]
    100592562
Enzymes [BR:nle01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     100592562
Peptidases [BR:nle01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   100592562
Exosome [BR:nle04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100592562
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 100592562
NCBI-ProteinID: XP_003270889
UniProt: G1QQL8
LinkDB All DBs
Position
13
AA seq 247 aa AA seqDB search
MNPLLILTFVAAAVAAPFDDDDKIVGGYTCEENSVPYQVSLNSGYHFCGGSLISEQWVVS
AAHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPKYNSRTLDNDILLIKLSSRAVIN
ARVSTISLPTASPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGEIT
SNMLGVGFLKGGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVDWIK
DTIAANS
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaatccactcctgatccttacctttgtggcagctgctgttgccgccccctttgacgat
gatgacaagatcgttgggggctacacctgtgaggagaattctgtcccctaccaggtgtcc
ctgaattctggctaccacttctgcggtggctccctcatcagcgaacagtgggtggtgtca
gcagctcactgttacaagtcccgcatccaggtgagactgggagagcacaacatcgaagtc
ctggaggggaatgaacagttcatcaatgcagccaagatcatccgccaccccaaatacaac
agcaggactctggacaatgacatcctgctgatcaagctctcctcacgtgcagtcatcaat
gcccgcgtgtccaccatctctctgcccaccgcctctccagccactggcacgaagtgcctc
atctctggctggggcaacactgcgagttctggtgctgactacccagatgagctgcagtgc
ttggacgctcctgtgctgagccaggctaagtgtgaagcctcttaccctggagagattacc
agcaacatgttgggcgtgggcttccttaagggaggcaaggattcctgccagggtgactct
ggtggccctgtggtctgcaatggacagcttcaaggagttgtctcctggggcgatggctgt
gcccagaagaacaagcctggagtctacaccaaggtctacaactatgtggactggattaag
gacaccatagctgccaacagctaa

DBGET integrated database retrieval system