KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100592827
Entry
100592827         CDS       T03265                                 

Gene name
RASSF1
Definition
(RefSeq) ras association domain-containing protein 1 isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04014  Ras signaling pathway
nle04390  Hippo signaling pathway
nle04392  Hippo signaling pathway - multiple species
nle05200  Pathways in cancer
nle05206  MicroRNAs in cancer
nle05219  Bladder cancer
nle05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100592827 (RASSF1)
   04390 Hippo signaling pathway
    100592827 (RASSF1)
   04392 Hippo signaling pathway - multiple species
    100592827 (RASSF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100592827 (RASSF1)
   05206 MicroRNAs in cancer
    100592827 (RASSF1)
  09162 Cancer: specific types
   05219 Bladder cancer
    100592827 (RASSF1)
   05223 Non-small cell lung cancer
    100592827 (RASSF1)
SSDB
Motif
Pfam: RA Nore1-SARAH DUF2252
Other DBs
NCBI-GeneID: 100592827
NCBI-ProteinID: XP_003257155
Ensembl: ENSNLEG00000006991
LinkDB
Position
4
AA seq 345 aa
MRSFLGAKRACPRPGVPPPMRQELDPGDLRFCLNGCGAALARAHAHTDTRTRTHATGAVV
GGYGRAGLRGRAGRAMGEAETPSFEMTWSSTTSSGYCSQEDSDSELEQYFTARTSLARRP
RRDQDEPVEWETPDLSQAEIEQKIKEYNAQINSNLFMSLNKDGSYTGFIKVQLKLVRPVS
VPSSKKPPSLQDARRGPGRGTSVRRRTSFYLPKDAVKHLHVLSRTRAREVIEALLRKFLV
VDDPRKFALFERAERHGQVYLRKLLDDEQPLRLRLLAGPSDKALSFVLKENDSGEVNWDA
FSMPELHNFLRILQREEEEHLRQILQKYSYCRQKIQEALHACPLG
NT seq 1038 nt   +upstreamnt  +downstreamnt
atgaggtcattcctgggggcgaagcgtgcgtgtccccgccccggcgttcctcccccaatg
agacaagagctagatcccggcgatctacgtttctgtcttaacggttgcggcgcggctctc
gcccgggcgcacgcgcacactgacacgcgtacacgcacgcacgcgaccggggcggtggtt
ggcggctacggacgcgcgggactacggggacgggcgggtagggctatgggcgaggcggag
acgccttctttcgaaatgacctggagcagcacgacgagcagtggctactgcagccaagag
gactcggactcggagctcgagcagtacttcaccgcgcgaacctcgctagcgcgcaggccg
cgccgggaccaggatgagcctgtggagtgggagacacctgacctttctcaagctgagatt
gagcagaagatcaaggagtacaatgcccagatcaacagcaacctcttcatgagcttgaac
aaggacggttcttacacaggcttcatcaaggttcagctgaagctggtgcgccctgtctct
gtgccctccagcaagaagccaccctccttgcaggatgcccggcggggcccaggacggggc
acaagtgtcaggcgccgcacttccttttacctgcccaaggatgctgtcaagcacctgcat
gtgctgtcacgcacaagggcacgtgaagtcattgaggccctgctgcgaaagttcttggtg
gtggatgacccccgcaagtttgcactctttgagcgggctgagcgtcacggccaagtgtac
ttgcggaagctgttggatgatgagcagcccctgcggctgcggctcctggcagggcccagt
gacaaggccctgagcttcgtcctgaaggaaaatgactctggggaggtgaactgggacgcc
ttcagcatgcctgaactacataacttcctgcgtatcctgcagcgggaggaggaggagcac
ctccgccagatcctgcagaagtactcctattgccgccagaagatccaagaggccctgcac
gcctgcccccttgggtga

DBGET integrated database retrieval system