KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100593010
Entry
100593010         CDS       T03265                                 

Definition
(RefSeq) 3-phosphoinositide-dependent protein kinase 1 isoform X1
  KO
K06276  3-phosphoinositide dependent protein kinase-1 [EC:2.7.11.1]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle01524  Platinum drug resistance
nle03320  PPAR signaling pathway
nle04068  FoxO signaling pathway
nle04071  Sphingolipid signaling pathway
nle04140  Autophagy - animal
nle04150  mTOR signaling pathway
nle04151  PI3K-Akt signaling pathway
nle04152  AMPK signaling pathway
nle04210  Apoptosis
nle04510  Focal adhesion
nle04660  T cell receptor signaling pathway
nle04664  Fc epsilon RI signaling pathway
nle04722  Neurotrophin signaling pathway
nle04910  Insulin signaling pathway
nle04919  Thyroid hormone signaling pathway
nle04931  Insulin resistance
nle04960  Aldosterone-regulated sodium reabsorption
nle05145  Toxoplasmosis
nle05205  Proteoglycans in cancer
nle05213  Endometrial cancer
nle05215  Prostate cancer
nle05223  Non-small cell lung cancer
nle05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100593010
   04071 Sphingolipid signaling pathway
    100593010
   04151 PI3K-Akt signaling pathway
    100593010
   04152 AMPK signaling pathway
    100593010
   04150 mTOR signaling pathway
    100593010
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100593010
  09143 Cell growth and death
   04210 Apoptosis
    100593010
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100593010
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    100593010
   04664 Fc epsilon RI signaling pathway
    100593010
  09152 Endocrine system
   04910 Insulin signaling pathway
    100593010
   03320 PPAR signaling pathway
    100593010
   04919 Thyroid hormone signaling pathway
    100593010
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100593010
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100593010
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100593010
   05231 Choline metabolism in cancer
    100593010
  09162 Cancer: specific types
   05215 Prostate cancer
    100593010
   05213 Endometrial cancer
    100593010
   05223 Non-small cell lung cancer
    100593010
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100593010
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100593010
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100593010
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nle01001]
    100593010
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nle04131]
    100593010
Enzymes [BR:nle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100593010
Protein kinases [BR:nle01001]
 Serine/threonine kinases: AGC group
  PDK1 family
   100593010
Membrane trafficking [BR:nle04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Acrosomal exocytosis proteins
    100593010
SSDB
Motif
Pfam: Pkinase PH_3 PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal APH Kdo
Other DBs
NCBI-GeneID: 100593010
NCBI-ProteinID: XP_030654772
Ensembl: ENSNLEG00000009437
LinkDB
Position
18
AA seq 556 aa
MARTTSQLYDAVPIQSSVVLCSCPSPSMVRTQTESSTPPGIPGGSRQGPAMDGTAAEPRP
GAGSLQHAQPLPQPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIK
ENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDET
CTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQARAN
SFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYD
FPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLTA
YLPAMSEDDEDCYGNYDNLLSQFGCMQVSSSSSSHSLSASDAGLPQRSGSNIEQYIHDLD
SNSFELDLQFSEDEKRLLLEKQAGGNPWHQFVENNLILKMGPVDKRKGLFARRRQLLLTE
GPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCRKIQ
EVWRQRYQSHPDAAVQ
NT seq 1671 nt   +upstreamnt  +downstreamnt
atggccaggaccaccagccagctgtatgacgccgtgcccatccagtccagcgtggtgtta
tgttcctgcccatccccatcaatggtgaggacccagactgagtccagcacgcctcctggc
attcctggtggcagcaggcagggacccgccatggacggcactgcagccgagcctcggccc
ggcgccggctccctgcagcacgcccagcctctgccgcagcctcggaagaagcggcctgag
gacttcaagtttgggaaaattcttggggaaggctctttttccacggttgtcctggctcga
gaactggcaacctccagagaatatgcgattaaaattctggagaagcgacatatcataaaa
gagaacaaggtcccgtatgtaaccagagagcgggatgtcatgtcgcgcctggatcacccc
ttctttgttaagctttacttcacatttcaggacgacgagaagctgtatttcggccttagt
tatgccaaaaacggagaactacttaaatatattcgcaaaatcggttcattcgatgagacc
tgtacccgattttacacggccgagattgtgtctgctttagagtacttgcacggcaagggc
atcattcacagggaccttaaaccggaaaacattttgttaaatgaagatatgcacatccag
atcacagattttggaacagcaaaagtcttatccccagagagcaaacaagccagggccaac
tcatttgtgggaacagcgcagtacgtttctccagagctgctcacggagaagtccgcctgt
aagagttcagacctttgggctcttggatgcataatataccagcttgtggcaggactccca
ccattccgagctggaaacgagtatcttatatttcagaagatcattaagttggagtatgac
tttccagaaaaattcttccctaaggcaagagacctcgtggagaaacttttggttttagac
gccacaaagcgattaggctgtgaggaaatggaagggtacggacctcttaaagcacacccg
ttcttcgagtccgtcacgtgggagaacctgcaccagcagacgcctccgaagctcaccgct
tacctgccggccatgtcggaagacgacgaggactgctatggcaattatgacaatctcctg
agccagtttggctgcatgcaggtgtcctcgtcctcctcctcacactccctgtcagcctcg
gacgcgggcctgccccagaggtcaggcagcaacatagagcagtacattcacgatctggac
tcgaactcctttgaactggacttacagttttccgaagatgagaagaggttgttgttggaa
aagcaggctggcggaaacccttggcaccagtttgtagaaaataatttaatactaaagatg
ggcccggtggataagcggaagggtttatttgcacgacgacgacagttgttgctcacagaa
ggaccacatttatattacgtggatcctgtcaacaaagtcctgaaaggtgaaattccttgg
tcacaagaacttcgaccagaggccaagaattttaaaactttctttgtccacacgcctaac
aggacgtactatctgatggaccccagcgggaacgcacacaagtggtgcaggaagatccag
gaggtttggaggcagcgataccagagccacccggacgccgctgtgcagtga

KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 115831277
Entry
115831277         CDS       T03265                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: putative 3-phosphoinositide-dependent protein kinase 2
  KO
K06276  3-phosphoinositide dependent protein kinase-1 [EC:2.7.11.1]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle01524  Platinum drug resistance
nle03320  PPAR signaling pathway
nle04068  FoxO signaling pathway
nle04071  Sphingolipid signaling pathway
nle04140  Autophagy - animal
nle04150  mTOR signaling pathway
nle04151  PI3K-Akt signaling pathway
nle04152  AMPK signaling pathway
nle04210  Apoptosis
nle04510  Focal adhesion
nle04660  T cell receptor signaling pathway
nle04664  Fc epsilon RI signaling pathway
nle04722  Neurotrophin signaling pathway
nle04910  Insulin signaling pathway
nle04919  Thyroid hormone signaling pathway
nle04931  Insulin resistance
nle04960  Aldosterone-regulated sodium reabsorption
nle05145  Toxoplasmosis
nle05205  Proteoglycans in cancer
nle05213  Endometrial cancer
nle05215  Prostate cancer
nle05223  Non-small cell lung cancer
nle05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    115831277
   04071 Sphingolipid signaling pathway
    115831277
   04151 PI3K-Akt signaling pathway
    115831277
   04152 AMPK signaling pathway
    115831277
   04150 mTOR signaling pathway
    115831277
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    115831277
  09143 Cell growth and death
   04210 Apoptosis
    115831277
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    115831277
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    115831277
   04664 Fc epsilon RI signaling pathway
    115831277
  09152 Endocrine system
   04910 Insulin signaling pathway
    115831277
   03320 PPAR signaling pathway
    115831277
   04919 Thyroid hormone signaling pathway
    115831277
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    115831277
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    115831277
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    115831277
   05231 Choline metabolism in cancer
    115831277
  09162 Cancer: specific types
   05215 Prostate cancer
    115831277
   05213 Endometrial cancer
    115831277
   05223 Non-small cell lung cancer
    115831277
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    115831277
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    115831277
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    115831277
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nle01001]
    115831277
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nle04131]
    115831277
Enzymes [BR:nle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     115831277
Protein kinases [BR:nle01001]
 Serine/threonine kinases: AGC group
  PDK1 family
   115831277
Membrane trafficking [BR:nle04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Acrosomal exocytosis proteins
    115831277
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal Kdo APH YukC RIO1
Other DBs
NCBI-GeneID: 115831277
NCBI-ProteinID: XP_030654776
LinkDB
Position
18
AA seq 388 aa
MVRTQTESSTAPGIPGGSTQGPAMDGTASEPQPGAGSLQHXPLPQPQKKRPEDFKFGKIL
GEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFT
FQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKP
ENILLNEDMHIQITDFGTAKVLSPESKQARANSFVGTAQYVSPELLTEKSACKSSDLWAL
GCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCE
EMEGYGPLKAHPFFESVTWENLHQQTPPKLTAYLPAMSEDDEDCYGNVSWPGWRARGVXL
HARAPDPRVICSRKGRVSLPVRQACWWL
NT seq 1167 nt   +upstreamnt  +downstreamnt
atggtgaggacccagactgagtccagcacagcccctggcattcctggtggcagcacgcag
ggccccgccatggacggcactgcatctgagcctcagcccggcgccggctccctgcagcac
nnaccactgccgcagcctcagaagaagcggcctgaggacttcaagtttgggaaaattctt
ggggaaggctctttttccacggttgtcctggctcgagaactggcaacctccagagaatat
gcgattaaaattctggagaagcgacatatcataaaagagaacaaggtcccgtatgtaacc
agagagcgggatgtcatgtcgcgcctggatcaccccttctttgttaagctttacttcaca
tttcaggacgacgagaagctgtatttcggccttagttatgccaaaaacggagaactactc
aaatatattcgcaaaatcggttcattcgatgagacctgtacccgattttacacggccgag
attgtgtctgctttagagtacttgcacggcaagggcatcattcacagggaccttaaaccg
gaaaacattttgttaaatgaagatatgcacatccagatcacagattttggaacagcaaaa
gtcttatccccagagagcaaacaagccagggccaactcatttgtgggaacagcgcagtac
gtttctccagagctgctcacggagaagtccgcctgtaagagttcagacctttgggctctt
ggatgcataatataccagcttgtggcaggactcccaccattccgagctggaaacgagtat
cttatatttcagaagatcattaagttggagtatgactttccagaaaaattcttccctaag
gcaagagacctcgtggagaaacttttggttttagacgccacaaagcggttaggctgtgag
gaaatggaagggtacggacctcttaaagcacacccgttcttcgagtccgtcacgtgggag
aacctgcaccagcagacgcctccgaagctcaccgcttacctgccggccatgtcggaagac
gacgaggactgctatggcaatgtaagctggccgggatggcgggcgaggggggtgnngctt
catgcccgtgcgccagacccacgtgtgatttgtagccgaaaggggagggtgtctctgcca
gtgcggcaggcctgttggtggttgtag

DBGET integrated database retrieval system