KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100593013
Entry
100593013         CDS       T03265                                 

Gene name
BAX
Definition
(RefSeq) apoptosis regulator BAX isoform X1
  KO
K02159  apoptosis regulator BAX
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle01521  EGFR tyrosine kinase inhibitor resistance
nle01522  Endocrine resistance
nle01524  Platinum drug resistance
nle04071  Sphingolipid signaling pathway
nle04115  p53 signaling pathway
nle04141  Protein processing in endoplasmic reticulum
nle04210  Apoptosis
nle04211  Longevity regulating pathway
nle04215  Apoptosis - multiple species
nle04217  Necroptosis
nle04722  Neurotrophin signaling pathway
nle04932  Non-alcoholic fatty liver disease
nle04933  AGE-RAGE signaling pathway in diabetic complications
nle05012  Parkinson disease
nle05014  Amyotrophic lateral sclerosis
nle05016  Huntington disease
nle05020  Prion disease
nle05022  Pathways of neurodegeneration - multiple diseases
nle05132  Salmonella infection
nle05152  Tuberculosis
nle05160  Hepatitis C
nle05161  Hepatitis B
nle05162  Measles
nle05163  Human cytomegalovirus infection
nle05164  Influenza A
nle05165  Human papillomavirus infection
nle05166  Human T-cell leukemia virus 1 infection
nle05167  Kaposi sarcoma-associated herpesvirus infection
nle05168  Herpes simplex virus 1 infection
nle05169  Epstein-Barr virus infection
nle05170  Human immunodeficiency virus 1 infection
nle05200  Pathways in cancer
nle05202  Transcriptional misregulation in cancer
nle05203  Viral carcinogenesis
nle05210  Colorectal cancer
nle05212  Pancreatic cancer
nle05213  Endometrial cancer
nle05214  Glioma
nle05216  Thyroid cancer
nle05217  Basal cell carcinoma
nle05218  Melanoma
nle05220  Chronic myeloid leukemia
nle05222  Small cell lung cancer
nle05223  Non-small cell lung cancer
nle05224  Breast cancer
nle05225  Hepatocellular carcinoma
nle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:nle00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100593013 (BAX)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    100593013 (BAX)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100593013 (BAX)
   04215 Apoptosis - multiple species
    100593013 (BAX)
   04217 Necroptosis
    100593013 (BAX)
   04115 p53 signaling pathway
    100593013 (BAX)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100593013 (BAX)
  09149 Aging
   04211 Longevity regulating pathway
    100593013 (BAX)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100593013 (BAX)
   05202 Transcriptional misregulation in cancer
    100593013 (BAX)
   05203 Viral carcinogenesis
    100593013 (BAX)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100593013 (BAX)
   05212 Pancreatic cancer
    100593013 (BAX)
   05225 Hepatocellular carcinoma
    100593013 (BAX)
   05226 Gastric cancer
    100593013 (BAX)
   05214 Glioma
    100593013 (BAX)
   05216 Thyroid cancer
    100593013 (BAX)
   05220 Chronic myeloid leukemia
    100593013 (BAX)
   05217 Basal cell carcinoma
    100593013 (BAX)
   05218 Melanoma
    100593013 (BAX)
   05213 Endometrial cancer
    100593013 (BAX)
   05224 Breast cancer
    100593013 (BAX)
   05222 Small cell lung cancer
    100593013 (BAX)
   05223 Non-small cell lung cancer
    100593013 (BAX)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100593013 (BAX)
   05014 Amyotrophic lateral sclerosis
    100593013 (BAX)
   05016 Huntington disease
    100593013 (BAX)
   05020 Prion disease
    100593013 (BAX)
   05022 Pathways of neurodegeneration - multiple diseases
    100593013 (BAX)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100593013 (BAX)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100593013 (BAX)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100593013 (BAX)
   05152 Tuberculosis
    100593013 (BAX)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100593013 (BAX)
   05170 Human immunodeficiency virus 1 infection
    100593013 (BAX)
   05161 Hepatitis B
    100593013 (BAX)
   05160 Hepatitis C
    100593013 (BAX)
   05164 Influenza A
    100593013 (BAX)
   05162 Measles
    100593013 (BAX)
   05168 Herpes simplex virus 1 infection
    100593013 (BAX)
   05163 Human cytomegalovirus infection
    100593013 (BAX)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100593013 (BAX)
   05169 Epstein-Barr virus infection
    100593013 (BAX)
   05165 Human papillomavirus infection
    100593013 (BAX)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100593013 (BAX)
   01524 Platinum drug resistance
    100593013 (BAX)
   01522 Endocrine resistance
    100593013 (BAX)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:nle03029]
    100593013 (BAX)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:nle02000]
    100593013 (BAX)
Mitochondrial biogenesis [BR:nle03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    100593013 (BAX)
Transporters [BR:nle02000]
 Other transporters
  Pores ion channels [TC:1]
   100593013 (BAX)
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 100593013
NCBI-ProteinID: XP_030676878
Ensembl: ENSNLEG00000004707
LinkDB
Position
10
AA seq 192 aa
MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLS
ECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAAEMFSDGNFNWGRVVALFYFASKL
VLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIVVAGV
LTASLTIWKKMG
NT seq 579 nt   +upstreamnt  +downstreamnt
atggacgggtccggtgagcagcccagaggcggggggcccaccagctctgagcagatcatg
aagacaggggcccttttgcttcagggtttcatccaggatcgagcagggcgaatggggggg
gaggcacccgagctggccctggacccggtgcctcaggatgcgtccaccaagaagctgagc
gagtgtctcaagcgcatcggggacgaactggacagtaacatggagctgcagaggatgatt
gctgccgtggacacagactccccacgagaggtctttttccgagtggcagctgaaatgttt
tctgacggcaacttcaactggggccgggttgtcgcccttttctactttgccagcaaactg
gtgctcaaggccctgtgcaccaaggtgcccgaactgatcagaaccatcatgggctggaca
ttggacttcctccgggagcggctgttgggctggatccaagaccagggtggttgggacggc
ctcctctcctactttgggacgcccacgtggcagaccgtgaccatcgttgtggctggagta
ctcaccgcctcactcaccatctggaagaagatgggctga

DBGET integrated database retrieval system