KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100593178
Entry
100593178         CDS       T03265                                 

Gene name
IL3
Definition
(RefSeq) interleukin-3
  KO
K04736  interleukin 3
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04060  Cytokine-cytokine receptor interaction
nle04151  PI3K-Akt signaling pathway
nle04210  Apoptosis
nle04630  JAK-STAT signaling pathway
nle04640  Hematopoietic cell lineage
nle04664  Fc epsilon RI signaling pathway
nle05200  Pathways in cancer
nle05202  Transcriptional misregulation in cancer
nle05221  Acute myeloid leukemia
nle05310  Asthma
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100593178 (IL3)
   04151 PI3K-Akt signaling pathway
    100593178 (IL3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100593178 (IL3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100593178 (IL3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100593178 (IL3)
   04664 Fc epsilon RI signaling pathway
    100593178 (IL3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100593178 (IL3)
   05202 Transcriptional misregulation in cancer
    100593178 (IL3)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    100593178 (IL3)
  09163 Immune disease
   05310 Asthma
    100593178 (IL3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:nle04052]
    100593178 (IL3)
   00536 Glycosaminoglycan binding proteins [BR:nle00536]
    100593178 (IL3)
Cytokines and growth factors [BR:nle04052]
 Cytokines
  Interleukins
   100593178 (IL3)
Glycosaminoglycan binding proteins [BR:nle00536]
 Heparan sulfate / Haparin
  Cytokines
   100593178 (IL3)
SSDB
Motif
Pfam: IL3 Ldl_recept_b
Other DBs
NCBI-GeneID: 100593178
NCBI-ProteinID: XP_003259977
Ensembl: ENSNLEG00000012611
UniProt: G1RQ11
LinkDB
Position
2
AA seq 152 aa
MSCLPVLLLLQLLVSPGLQAPMTQTMSLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLN
GEDQDILMENNLRRPNLEAFNKAVKSLQNASAIESILKNLPPCLPMATAAPTRHPIRIKD
GDWNEFRRKLKFYLKTLENEQAQQMTLSLEIS
NT seq 459 nt   +upstreamnt  +downstreamnt
atgagctgcctgcccgtcctgctcttgctccaactcctggtcagccccggactccaagct
cccatgacccagacaatgtccttgaagacaagctgggttaactgctctaacatgatcgat
gaaattataacacacttaaagcagccacctttgcccttgctggacttcaacaacctcaat
ggggaagaccaagacattctgatggaaaataaccttcgaaggccaaacctggaggcattc
aacaaggctgtcaagagtttacagaatgcatcagcaatcgagagcattcttaagaatctc
cccccatgcctgcccatggccacggccgcacccacgcgacatccaatccgtatcaaggac
ggtgactggaatgaattccggaggaaactgaagttctatctgaaaacccttgagaatgag
caagctcaacagatgactttgagccttgagatctcttga

DBGET integrated database retrieval system