KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100593312Help
Entry
100593312         CDS       T03265                                 

Gene name
PYCARD
Definition
(RefSeq) PYD and CARD domain containing
  KO
K12799  apoptosis-associated speck-like protein containing a CARD
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04217  Necroptosis
nle04621  NOD-like receptor signaling pathway
nle04623  Cytosolic DNA-sensing pathway
nle04625  C-type lectin receptor signaling pathway
nle05132  Salmonella infection
nle05133  Pertussis
nle05134  Legionellosis
nle05135  Yersinia infection
nle05164  Influenza A
Brite
KEGG Orthology (KO) [BR:nle00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100593312 (PYCARD)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100593312 (PYCARD)
   04623 Cytosolic DNA-sensing pathway
    100593312 (PYCARD)
   04625 C-type lectin receptor signaling pathway
    100593312 (PYCARD)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100593312 (PYCARD)
   05135 Yersinia infection
    100593312 (PYCARD)
   05133 Pertussis
    100593312 (PYCARD)
   05134 Legionellosis
    100593312 (PYCARD)
  09172 Infectious disease: viral
   05164 Influenza A
    100593312 (PYCARD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CARD PYRIN
Motif
Other DBs
NCBI-GeneID: 100593312
NCBI-ProteinID: XP_003280507
UniProt: G1S2K3
LinkDB All DBs
Position
2
AA seq 195 aa AA seqDB search
MGRARDAILDALENLTAEELKKFKLKLLSVPLREGYGRIPRGALLSMDALDLTDKLVSFY
LEAYGAELTANVLRDMGLQEMAGQLQAATHQGSGAAPAGIQAPLQSAAKPDLHFIDQHRA
ALIARVTNVECLLDALYGKVLMEEQYQAVRAEPTNPSKMRKLFSFTPAWNWTCKDLLLQA
LRESQSYLVEDLERS
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggggcgcgcgcgcgacgccatcctggatgcgctggagaacctgaccgccgaggaactc
aagaagttcaagctgaagctgctgtcggtgccgctgcgcgagggctacgggcgcatcccg
cggggcgcgctgctgtccatggacgccttggacctcaccgacaagctggtcagcttctac
ctggaggcctacggcgccgagctcaccgctaacgtgctgcgcgacatgggcctgcaggag
atggccgggcagctgcaggcggccacgcaccagggctctggagccgcgccagctgggatc
caggcccctcttcagtcggcagccaagccagacctgcactttatagaccagcaccgggct
gcgcttatcgcgagggtcacaaacgttgagtgcctgctggatgccctgtatgggaaggtc
ctgatggaagagcagtaccaggcagtgcgggccgagcccaccaacccaagcaagatgcgg
aagctcttcagcttcacaccagcctggaactggacctgcaaggacttgctcctccaggcc
ctaagggagtcccagtcctacctggtggaggacctggagcggagctga

DBGET integrated database retrieval system