KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100593390
Entry
100593390         CDS       T03265                                 

Gene name
MLH1
Definition
(RefSeq) DNA mismatch repair protein Mlh1 isoform X2
  KO
K08734  DNA mismatch repair protein MLH1
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle01524  Platinum drug resistance
nle03430  Mismatch repair
nle03460  Fanconi anemia pathway
nle05200  Pathways in cancer
nle05210  Colorectal cancer
nle05213  Endometrial cancer
nle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:nle00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    100593390 (MLH1)
   03460 Fanconi anemia pathway
    100593390 (MLH1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100593390 (MLH1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100593390 (MLH1)
   05226 Gastric cancer
    100593390 (MLH1)
   05213 Endometrial cancer
    100593390 (MLH1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100593390 (MLH1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:nle03400]
    100593390 (MLH1)
DNA repair and recombination proteins [BR:nle03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    MutL homologs
     100593390 (MLH1)
SSDB
Motif
Pfam: Mlh1_C DNA_mis_repair HATPase_c_3 HATPase_c
Other DBs
NCBI-GeneID: 100593390
NCBI-ProteinID: XP_003256894
Ensembl: ENSNLEG00000004886
UniProt: G1QYL9
LinkDB
Position
4
AA seq 756 aa
MSFVAGVIRRLDETVVNRIAAGEVIQRPANAIKEMIENCLDAKSTSIQVIVKEGGLKLIQ
IQDNGTGIRKEDLDIVCERFTTSKLQSFEDLASISTYGFRGEALASISHVAHVTITTKTA
DGKCAYRASYSDGKLKAPPKPCAGNQGTQITVEDLFYNIATRRKALKNPSEEYGKILEVV
GRYSIHNAGISFSVKKQGETVADVRTLPNASTVDNIRSIFGNAVSRELIEIGCEDKTLAF
KMNGYISNANYSVKKCIFLLFINHRLVESTSLRKAIETVYAAYLPKNTHPFLYLSLEISP
QNVDVNVHPTKHEVHFLHEESILERVQQHIESKLLGSNSSRMYFTQTLLPGLAGPSGEMV
KSTTSLTSSSTSGSSDKVYAHQMVRTDSREQKLDAFLQPLSTPLSSQPQAVVTEDKTDIS
SGRAMQQDEEMLELPAPAEVAAKNQSSEGDTTKGTSEMSEKRGPTSSNPRKRYREDSDVE
MVEDDSRKEMTAACTPRRRIINLTSVLSLQEEINERGHEVLREMLHNHSFVGCVNPQWAL
AQHQTKLYLLNTTKLSEELFYQILIYDFANFGVLRLSEPAPLFDLAMLALDSPESGWTEE
DGPKEGLAEYIVEFLKKKAEMLADYFSLEIDEEGNLIGLPLLIDNYVPPLEGLPIFILRL
ATEVNWDEEKECFESLSKECAMFYSIRKQYVSEESTLSGQQSEVPGSIPNSWKWTVEHIV
YKALRSHILPPKHFTEDGNILQLANLPDLYKVFERC
NT seq 2271 nt   +upstreamnt  +downstreamnt
atgtcgttcgttgcaggggttattcggcggctggacgagacagtggtgaaccgcatcgcg
gcgggggaagttatccagcggccagctaatgctatcaaagagatgattgagaactgttta
gatgcaaaatccacaagtattcaagtgattgttaaagagggaggcctgaagttgattcag
atccaagacaatggcaccgggatcaggaaagaagatctggatatcgtatgtgaaaggttc
actactagtaaactgcagtcctttgaggatttagccagtatttctacctatggctttcga
ggtgaggctttggccagcataagccatgtggctcatgttactattacaacgaaaacagct
gatggaaagtgtgcatacagagcaagttactcagatggaaaactgaaagctcctcctaaa
ccatgtgctggtaatcaagggacccagatcacggtggaggaccttttttacaacatagcc
acgaggagaaaagctttaaaaaatccaagtgaagaatatgggaaaattttggaagttgtt
ggcaggtattcaatacacaatgcaggcattagtttctcagttaaaaaacaaggagagaca
gtagctgatgttaggacactacccaatgcctcaaccgtggacaatattcgctccatcttt
ggaaatgctgttagtcgagaactgatagaaattggatgtgaggataaaaccctagccttc
aaaatgaatggttacatatccaatgcaaactactcagtgaagaagtgcatcttcttactc
ttcatcaaccatcgtctggtagaatcaacttccttgagaaaagccatagaaacagtgtat
gcagcctatttgcccaaaaacacacacccattcctgtacctcagtttagaaatcagtccc
cagaatgtggatgttaatgtgcaccccacaaagcatgaagttcacttcctgcacgaggag
agcatcctggagcgggtgcagcagcacatcgagagcaagctcctgggctccaattcctcc
aggatgtacttcacccagactttgctaccaggacttgctggcccctctggggagatggtt
aaatccacaacaagcctgacctcctcttctacttctggaagtagtgacaaggtctatgcc
caccagatggttcgtacagattcccgggaacagaagcttgatgcatttctgcagcctctg
agcacacccctgtccagtcagccccaggccgttgtcacagaggataagacagatatttct
agtggcagggccatgcagcaagatgaggagatgcttgaactcccagccccagctgaagtg
gctgccaaaaatcagagctcggagggggatacaacaaaggggacttcagaaatgtcagag
aagagaggacccacttccagcaaccccagaaagagatatcgggaagattctgatgtggaa
atggtggaagatgattcccgaaaggaaatgactgcagcttgtaccccccggagaaggatc
attaacctcaccagtgttttgagtctccaggaagaaattaatgagcggggacatgaggtt
ctccgggagatgttgcataaccactccttcgtgggctgtgtgaatcctcagtgggccttg
gcacagcatcagaccaagttataccttctcaacaccaccaagctgagtgaagaactgttc
taccagatactcatttatgattttgccaattttggtgttctgaggttatcggagccagca
ccgctctttgaccttgccatgcttgccttagatagtccagagagtggctggacagaggaa
gatggtcccaaagaaggacttgctgaatacattgttgagtttctgaagaagaaggctgag
atgcttgcagactatttctctttggaaattgatgaggaagggaacctgattggattaccc
cttctgattgacaactatgtgccccctttggagggactgcctatcttcattcttcgacta
gccactgaggtgaattgggacgaagaaaaggaatgttttgaaagcctcagtaaagaatgt
gctatgttctactccatccggaagcagtacgtatctgaggagtcgaccctctcaggccag
cagagtgaagtgcctggctccattccaaactcctggaagtggactgtggaacacattgtc
tataaagccttgcgctcacacattctgcctcctaaacatttcacagaagatggaaatatc
ctgcagcttgctaacctgcctgatctatacaaagtcttcgagaggtgttaa

DBGET integrated database retrieval system