KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100593432Help
Entry
100593432         CDS       T03265                                 

Gene name
GADD45G
Definition
(RefSeq) growth arrest and DNA damage inducible gamma
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04010  MAPK signaling pathway
nle04068  FoxO signaling pathway
nle04110  Cell cycle
nle04115  p53 signaling pathway
nle04210  Apoptosis
nle04218  Cellular senescence
nle05169  Epstein-Barr virus infection
nle05200  Pathways in cancer
nle05202  Transcriptional misregulation in cancer
nle05210  Colorectal cancer
nle05212  Pancreatic cancer
nle05213  Endometrial cancer
nle05214  Glioma
nle05216  Thyroid cancer
nle05217  Basal cell carcinoma
nle05218  Melanoma
nle05220  Chronic myeloid leukemia
nle05222  Small cell lung cancer
nle05223  Non-small cell lung cancer
nle05224  Breast cancer
nle05225  Hepatocellular carcinoma
nle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100593432 (GADD45G)
   04068 FoxO signaling pathway
    100593432 (GADD45G)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100593432 (GADD45G)
   04210 Apoptosis
    100593432 (GADD45G)
   04115 p53 signaling pathway
    100593432 (GADD45G)
   04218 Cellular senescence
    100593432 (GADD45G)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100593432 (GADD45G)
   05202 Transcriptional misregulation in cancer
    100593432 (GADD45G)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100593432 (GADD45G)
   05212 Pancreatic cancer
    100593432 (GADD45G)
   05225 Hepatocellular carcinoma
    100593432 (GADD45G)
   05226 Gastric cancer
    100593432 (GADD45G)
   05214 Glioma
    100593432 (GADD45G)
   05216 Thyroid cancer
    100593432 (GADD45G)
   05220 Chronic myeloid leukemia
    100593432 (GADD45G)
   05217 Basal cell carcinoma
    100593432 (GADD45G)
   05218 Melanoma
    100593432 (GADD45G)
   05213 Endometrial cancer
    100593432 (GADD45G)
   05224 Breast cancer
    100593432 (GADD45G)
   05222 Small cell lung cancer
    100593432 (GADD45G)
   05223 Non-small cell lung cancer
    100593432 (GADD45G)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    100593432 (GADD45G)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:nle03036]
    100593432 (GADD45G)
Chromosome and associated proteins [BR:nle03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     100593432 (GADD45G)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     100593432 (GADD45G)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L7Ae
Motif
Other DBs
NCBI-GeneID: 100593432
NCBI-ProteinID: XP_003281940
UniProt: G1QHZ9
LinkDB All DBs
Position
1a
AA seq 159 aa AA seqDB search
MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFC
VLAADEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCI
LISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgactctggaagaagtccgcggccaggacacagttccggaaagcacagccaggatgcag
ggtgccgggaaagcgctgcacgagttgctgctatcggcgcagcgtcagggctgcctcact
gccggcgtctacgagtcagccaaagtcctgaacgtggaccccgacaatgtgaccttctgt
gtgctggctgccgatgaggaggacgagggcgacatcgcgctgcagatccattttacgctg
atccaggctttctgctgcgagaacgacatcgacatagtgcgcgtgggcgatgtgcagcgg
ctggcggctatcgtgggcgccggcgaggaggcgggtgcgccgggcgacctgcactgcatt
ctcatttcgaaccccaacgaggacgcctggaaggatcccgccttggagaagctcagcctg
ttttgcgaggagagccgcagcgttaacgactgggtgcccagcatcaccctccccgagtga

DBGET integrated database retrieval system